ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_001900 ()

dihydrolipoamide acetyltransferase, putative, a gene from Plasmodium vivax

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10806

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_050500 dihydrolipoamide acyltransferase, putative
  • PY04573 putative dihydrolipoamide S-acetyltransferase
  • PVX_001900 dihydrolipoamide acetyltransferase, putative
  • PCHAS_050510 dihydrolipoamide acyltransferase, putative
  • PKH_060480 dihydrolipoamide acetyltransferase, putative
  • NCLIV_044290 Pyruvate dehydrogenase E2 component, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PVX_001900 dihydrolipoamide acetyltransferase, putative
MLLLWLPFFLLLRTSTCISLPNKHGFITTLNHAWAKSPHNKMKNRRGVIFSQIEIKMPALSSTMTSGKIVKWNKDVGEYV
NLGDIIMTVESDKADMDVEAFDEGFLRVKHMGDGSEAKVGDTLGILTTEEDEEIEAPSDDFPAGGTTPQGGITSHGDITP
EGETTPQGDSPHAQAPQPAQQQTGERKIFLPFVSTKRNRARISKWTRKENDRIEKDEVLFHVEDDKSTIEVESPCNGVVK
KIFIEEGQFADFEKPVAIISPRKAEDPPQGEQTEDVQPVNEENVVRHYREALSGTREGELLLQNMSASDKRTMEERLLLN
YDKYTPLSRDFFSSRDDGTPGKGSTGQKRDTVMEQNKLTPADIKGTKVPGRITYEDVISHLERTKGETPAKAKIIELTNV
QKAIKNNMMRTLSIPVFRITHFIKTNALLKLYEQVKDKINMTVLLCKCVAKVLLKHPIIYSTFIDEGEGKILFNEDVHIG
NALGLKNSLLTPVLKRVNKADIYTLAGEWKKLVEKGKQGLLTAGEMSGSNFYISNLGMLNTYQFDATLPPNVSCILSVGT
NIARVENLEDLKIQRGMMMTLTCDHRHIYGSHAAAFMSDLAAFVERDIMQVFL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_001900

General Sub-Cellular Localisation Links