ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_000995 (Pv41)

transmission-blocking target antigen Pfs230, putative, a gene from Plasmodium vivax

Compiled localisation
surface during schizont

Who localised this protein by microscopy?

Angel, D. I., Mongui, A., Ardila, J., Vanegas, M., Patarroyo, M. A.
The Plasmodium vivax Pv41 surface protein: identification and characterization. (2008 Dec 26, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

surface during schizont
  • "We have also demonstrated Pv41 transcription and expression during late intra-erythrocytic parasite stages and defined its subcellular localization on the parasite surface."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to whole protein
  • Strain: VCG-I
  • Gene model mapping comments: taken directly from 18983983
  • Localisation record: parasite surface during schizont
  • Comment: The Vivax-Colombia Guaviare I (VCG-I) P. vivax strain
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48333

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_000995 transmission-blocking target antigen Pfs230, putative
MKRLLLLALLHLVRQQLPAHAEEHICDFTKEKYLLGKNEKEYCVVNAKPFDSVTFICPKKIGAQCFQNVNTLDDISADKM
ESSKLSIDVLLYGSTLYGDTLLISPTVKQSTTFYCFCNLQMEDLKKYLKKRRLTKEKENAKKKSTVNVNDLKNADEDMEV
VVPEKQIDEHLVRALYRVKKIRNIIEREKNKGEGDKPTNPEDEEELVIEEEQEEEDGEGDEEDESKVEKIITKYGIMKVV
VSTNNTITKGCDFGNNVVNYFSKPYPVERYGGSKVCRIEAKPGEFVGFKCIYDNQGTVEPHNCFDKVFYEGNETDLQTLM
PGYISYGNKQKGKYAFYLKLPHFVQHSYTVQCKCRSTVHQYDDYVFELAVEGGESDIVAKSFQE

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_000995

General Sub-Cellular Localisation Links