ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

J03992 (CS)

gi|160220|gb|J03992.1|PFACSPG Plasmodium malariae (clone 255A) circumsporozoite protein (CSP) gene, complete cds, a gene from Plasmodium malariae

Compiled localisation
inner surface of peripheral vacuoles during oocyst maturation
plasma membrane during sporoblast
during not sporozoites ruptured into the midgut lumen
surface during sporozoites ruptured into midgut epithelial cells

Who localised this protein by microscopy?

Nagasawa, H., Aikawa, M., Procell, P. M., Campbell, G. H., Collins, W. E., Campbell, C. C.
Plasmodium malariae: distribution of circumsporozoite protein in midgut oocysts and salivary gland sporozoites. (1988 Jun, Exp Parasitol) PubMed / full text
   more detail about this publication

inner surface of peripheral vacuoles during oocyst maturation, plasma membrane during sporoblast, during not sporozoites ruptured into the midgut lumen, surface during sporozoites ruptured into midgut epithelial cells
  • "Gold label was detected on the inner surface of peripheral vacuoles during oocyst maturation and the plasma membrane of the sporoblast. Salivary gland sporozoites and budding sporozoites in mature oocysts were labeled uniformly on the outer surface of their plasma membranes. The surface of sporozoites that ruptured into midgut epithelial cells were entirely covered with gold particles."
  • Microscopy type: EM
  • Microscopy method: monoclonal antibody directly to whole protein
  • Strain:
  • Gene model mapping comments: J03992 taken directly from publication
  • Localisation record: inner surface of peripheral vacuoles during oocyst maturation, plasma membrane during sporoblast, not during sporozoites ruptured into the midgut lumen, surface during sporozoites ruptured into midgut epithelial cells
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>J03992 gi|160220|gb|J03992.1|PFACSPG Plasmodium malariae (clone 255A) circumsporozoite protein (CSP) gene, complete cds
MKKLSVLAISSFLIVDFLFPGYHHNSNSTKSRNLSELCYNNVDTKLFNELEVRYSTNQDHFYNYNKTIRLLNENNNEKDG
NVTNERKKKPTKAVENKLKQPPGDDDGAGNDAGNDAGNDAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAA
GNDAGNAAGNAAGNAAGNAAGNAAGNDAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNDAGNAAGNAA
GNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNAAGNEKAKNK
DNKVDANTNKKDNQEENNDSSNGPSEEHIKNYLESIRNSITEEWSPCSVTCGSGIRARRKVGAKNKKPAELVLSDLETEI
CSLDKCSSIFNVVSNSLGIVLVLVLILFH

Proteomics

Found in:

Not found in:

Gene-Specific Links for J03992

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins