ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_146980 (NBPXb)

reticulocyte binding protein, putative (fragment), a gene from Plasmodium knowlesi

Compiled localisation
microneme during merozoite

Who localised this protein by microscopy?

Meyer, E. V., Semenya, A. A., Okenu, D. M., Dluzewski, A. R., Bannister, L. H., Barnwell, J. W., Galinski, M. R.
The reticulocyte binding-like proteins of P. knowlesi locate to the micronemes of merozoites and define two new members of this invasion ligand family. (2009 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during merozoite
  • "Rabbit antisera specific for recombinant PkNBPXa and PkNBPXb confirmed expression of the prospective high molecular weight proteins and localized these proteins to the apical end of merozoites. Their precise location, as determined by immuno-electron microscopy (IEM), was found to be within the microneme organelles."
  • Microscopy type: light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from EU867792, annotation matches
  • Localisation record: microneme during merozoite
  • Other genes localised in this publication: reticulocyte binding protein, putative (fragment)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12977

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PKH_146980 reticulocyte binding protein, putative (fragment)
KNRIPSEKRIDVNSVIPEISEKLYSMNRKIRTTITNLNGLLEEGKTCEKSFYASMIAGISSQMSNDLILINNQKEEAEKY
VEYIKKNSNLMIDDIDELNKYIDSNKINNYQLNILEEVIKSAADLSENEKEAAGIDNDIKKELVDVSGDFEMNSLNSSKA
KIMEHYKKMKDKIKNIDDIRKNIKLLKLKEMESRSDKYLEIAGNFKNVLDSQITRLLDYDVVLQDMKKKLTENEEELKGI
NTTYTLQSIQKFNNVCNNIETNMQKIHDVEESNNNEEKQVNAYIENISHLISRGKGLLTDLDDYDAISNSETKELTDYTT
KEYIENIKRKVNNGIEEFQNVLNRIEENKSKIEYNKNLNEGIYEIWKRANAIKENFSENLPENDNYFKLEEYVKDIKIIL
NEIDGDGKIEAYIENISQRIQEQIKHAHNNGNIESILEAKKNIESYNEEARKKLQSMKTAHDEILLKKKDMDNIFSIISV
SKKNGAYINAKAYIKEVDDLFDKLNADIHKLETFINETKLKINLLEEEEVKLKTENAVTSNLNEQSENTSRDGDDEQLSE
VTQNPENSEYSSTNSLHNVYELEENDQYDANHFDDNAKEESDDGSYNSSEKSSGEGFRYAAGITVAFFICSTAGYTVFTY
NNDEVEEADFEKDREYFEYDIYSNKRDEEEIIEVTFDESNEYI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_146980

General Sub-Cellular Localisation Links