ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_143910 ()

transcription factor with AP2 domain(s), putative, a gene from Plasmodium knowlesi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PKH_143910 transcription factor with AP2 domain(s), putative
MQPQNKELTEKTTHLDTIMIGRFKSEHRHCGNTLTDNFEQKVNFTPCAAGESGNCLYALCTSQPSTTETFNLGITRRSRL
SRNRETSYQYNTLIRKFNEEARNCYCANRNRQNFTLKWTLNRSKKVSNKSRAIIKRTGRMYQKKILSMNSSISSDFVSRG
KKGTNMRRFEEGRFRRLNVLSAKKEMLSFINTDASALKDMFLGNIHRSDSCSHGGNIYGDRNNDMCVAAFKCCDHFVGHA
NCANYMLADATVGTEAALTPMEDRRETDGLKLKIDNSNIVDLMNEGNTHISEQREKNEHKEEICNSSHENINLERGKSKC
SWKKKGLKIEKEQEDADKDVVGRSTLYYGMENKLEFPVNIEETSPSNNPPKDGRWRRRRTAPKNGSNVSAWKNVKKECIS
NTGICPNGCPEEDMNIEGLNDEFSNHWRNDEKEHYGEENKMYVPCITIEEELEFNNAGTPSIWLRNTEPIEEFKEHPEEE
SPINSCNKWNIVSKNVNRNVSPYESEIFIPYEEMEKEHAPNNEMMHSGIRRNEHMYESNLAVPLNHFNAPSQGWNYYMAN
KIGTHRTACLCTEGVGLSKGTQWNRNNYIDMESCIEELSGRSISEGNLYEGQHIANGISNEHASMGNMWHGYYTACSEVE
SNLVVNCQVSSHAVEGNPVGTYSLGSYWVDIYPVERYPAEIYPLASNWVGSNRMEMCPPGWVMKKDQCYSVPEVHAEEEA
FASGSANPWEREEMGKEEQQSAHTNTCSLSSMKKEELTLPSNVTKMEKHVKRKVNVHSILNNNRSLSCGMKREIKMEVPD
TGVYLTQGATSKLHTIADRERSEAPTARTSSIIPILDNDHLADTLGNQFDLENNREMLYSIPGELPDDRRLVCPHTHMLD
ANVSANIRVADGTACTALIRSNTNAGILVVCSRSQGQGENELIFPYNDVIHDNNEAFSEVATNSYYIPYPTWDNYPNLGM
QEKFREYQYPYISSICPNECMSISGDYCADYPYNRPIDVNNSGEVDPKYSNHYFYPSWDNSLQCSGAEAIRNYNGICCDS
TCSCNGGNICDENLGCNNGESSQGGKNSHYTDTFSKHGGNSCTRNTYHKLRRSKSLITQGYTYYQNDPQMVISDASNNLK
DQYSQRSSKKRDSFTRFSVKGEYYSTSNTSNTDVISENSFLLIKGDNNSITGHIGREQMDPKDETDVIPDGKHQSDQYIH
RGACSGTLHDSASNFSSYPVVNLMEGESYSPRRSGKWEVMPRTSNNNASDGYGRMKEHVELKLESRNVQLGNPEGYVEGL
LPGDDKGGHTNDMKVKVKREASSDVQSRYESGNESDSHRGDQLNDQLNDQLYDLQMIAVDNAHNTRSAKNDESTHAKGES
GEANSPNYCRTKCTTDGIHNYNNHEVGNLSADRANSIINSDKPYDGCFLEDDSKGSCRDALCTNGDKTFARQEAPKNILK
NISACDRWNSGKDSSNLCSYDSNGRREYDACGYLSRINLPHISDQRVYKIRYPVNDGCSDFSHSSRENMQSNHHINRMGT
TNQVNFPYGDCSRNYVNADPSESVTHITGDGSYPRDNFYNISDYQHSPNGTNYGDKWNNSSGTFPLWWTPCHGNNGDSLK
KPLYFLQDKFSTASDEVKHPSVNKNNTNETNMYMVTNGTTLKKELKADTNSSEGTNSFRIKSEVANEDSMNLTNVPMSSE
CNSTLDTNTNPLSNNTYNLLSISTKCDSLGFSNDDGTRVHGEESPSGVNQGEKINTIVVEEQPYRAYIPDGNSNTFQIYE
GNGTKDGEQVNTHTWGGNHFGTCVMENMETFEGGINLRKMPSSQMCIPRVKDENEGSSTEIGSQKDEENGVGCTPQNYAR
CEGEGDMHTNEEMRDEGSMSVNTGINERVNANNGDVSTYENRTQGTHDGNIVQNLNEMDTHLKNMNCMYTPEKYNYLNEA
YFLSNPVNEVNFPNGVWQERNSLNHANYEEYIQQYSYSHSYMSGMGGNFNVERKGENADRGSGDNEDGKSDRPSDSGEKH
TNGAMPHSIGMPIECANSIYDHQDVSGSAYYPGHIANNSNAIYGGMTGNGGNVQGILDQTGFDCMNSAMYNGTSPSGVNH
TDRNIVAGYSYGYPSGLCGNYPYGYAYEMNTHSYADENKSVSQSCTLENTNGSTEDVHNISDAQVDRVSCKYIESDNDGA
DASDEDTDDGTGDETEDTDQEMSSENAEEKKASVSIVNVENVNNTTEGNPIITSESRTTITNLGSESNANGGSITRVTEN
SSSTMEGETSPNGVNSVKSESTACSFNETHKKDRCIENCKGEKMDHGVEAKSEKVVKRRGRKKNNSDDFKYAHEKKKELL
KKKYNVQKDVVLTVEEGDLKLIAEEIIKNTSLLPERGPYGRNALDASHPIHSVWKDTSRGHSSWRCRWWENGKRLSKNYN
VKRYGEEDALKMAIITKLRNSSPADRILYLNHQREFLNLCYANNWIQKRESDRAEADQDTAKITLQKDDITKGEKRSKRS
TTGDMDAHETNKECNQEKDSKTIHLSVPSITYSTNTSPDDAKAPLHGNNLRRKNKRTLLTNTRSSKKCRTLKCYPSGPNT
DTMRHAQEGDGTDGISERNAMHEVSAPNAVHVVNTQGDVKLEVI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_143910

General Sub-Cellular Localisation Links