ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_141120 ()

malonyl CoA-acyl carrier protein transacylase precursor, putative, a gene from Plasmodium knowlesi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11305

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0066 malonyl CoA-acyl carrier protein transacylase precursor
  • PBANKA_141050 malonyl CoA-acyl carrier protein transacylase precursor, putative
  • PY05492 malonyl CoA-acyl carrier protein transacylase precursor
  • PVX_122435 malonyl CoA-acyl carrier protein transacylase precursor, putative
  • PCHAS_141240 malonyl CoA-acyl carrier protein transacylase precursor, putative
  • PKH_141120 malonyl CoA-acyl carrier protein transacylase precursor, putative
  • TGME49_025990 malonyl CoA-acyl carrier protein transacylase, putative
  • NCLIV_046840 Acyl-carrier-protein S-malonyltransferase (EC 2.3.1.39), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PKH_141120 malonyl CoA-acyl carrier protein transacylase precursor, putative
MHIITSRTVLTISIIVIKIILWNSEECKGFILKGKERAVSGVLRRGMDKKNRRRLTKEENLRDQINEQIMTSSENDNYIK
KKLKEFEKYRIATYSSQYTFFFPGQGEQYISMGLDTYNTCKNAKEMYDRASKILGYNLMDIIKNGPIEKLKDSEISQPSI
YTVSIAAYEKLKQEKQDIVMKLNLCMGYSLGEYSALTCSEALPFEEGVFLTKERGKAMQNCAKLYKTTTIAIVGLTLDRI
HNLIEDVNKEMDDDIFIVSYMTPKKFGLCGKPESMQYLNKLAKEKYKAIFTKELQISGGFHSSYMFPARKALENALRQII
FRKPKIPVISNVDGCAYDDPHIIKQLLLLQLTSPIRINACLENVLKHGYETGYELGPGTINSNLLKDVSKKQKEATPYI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_141120

General Sub-Cellular Localisation Links