ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_120870 ()

isocitrate dehydrogenase [NADP], mitochondrial precursor, putative, a gene from Plasmodium knowlesi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10559

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0242 isocitrate dehydrogenase (NADP), mitochondrial precursor
  • PBANKA_135860 isocitrate dehydrogenase (NADP), mitochondrial precursor, putative
  • PY00592 isocitrate dehydrogenase, NADP-dependent
  • PY02505 isocitrate dehydrogenase, NADP-dependent, putative
  • PVX_083185 isocitrate dehydrogenase [NADP], mitochondrial precursor, putative
  • PCHAS_136320 isocitrate dehydrogenase (NADP), mitochondrial precursor, putative
  • PKH_120870 isocitrate dehydrogenase [NADP], mitochondrial precursor, putative
  • NCLIV_039280 Isocitrate dehydrogenase-like protein, related
  • NCLIV_056480 hypothetical protein
  • CMU_033490 isocitrate dehydrogenase, putative
  • TA10850 isocitrate dehydrogenase, putative
  • BBOV_III007260 isocitrate dehydrogenase, NADP-dependent family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PKH_120870 isocitrate dehydrogenase [NADP], mitochondrial precursor, putative
MGGRTQLWRNPWIQNTTRRNASKSAAFNICGKVKVQNPVVELDGDEMTKIIWKDIKEKLILPYLDLNIKYFDLSIENRDK
TNDQVTLEAAEEIKKSSVGIKCATITPDAARVKEFNLKQMWKSPNGTIRNILDGTVFRAPILIKNIPRLIPNWKKPIIIG
RHAYADQYKQKSLKIDKSGKFEIVFTPDDKSEVMREEIFHFKSPGVCLGMYNTEESITNFALSCFQYALDLKMPVYMSTK
STILKIYDGLFMEIFQKIYDEKFRTLFEKNNLWYEHKLIDDMVAQVLKSEGGFVWACKNYDGDIQSDAVAQGYGSLGLMS
SILMCPDGVTCVSEAAHGTVTRHYRCHQRGEKTSTNPIASIFAWTRGLQHRAKLDKNQPLQLFCYALESACIETVEDGLM
PKDLAACIKGLKNVTEKDYLFTDDFINAINEKLKLKLLANQAKNEAQAATTTKLQNENWNNYAPQEHSS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_120870

General Sub-Cellular Localisation Links