ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_091580 ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium knowlesi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22181

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_092970 haloacid dehalogenase-like hydrolase, putative
  • PY04231 o238, putative
  • PVX_091555 haloacid dehalogenase-like hydrolase, putative
  • PCHAS_091460 haloacid dehalogenase-like hydrolase, putative
  • PKH_091580 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PKH_091580 conserved Plasmodium protein, unknown function
MDGEKCFYITEKGKKQNFKNIKLITFDLDHTIWNIDGLLNYADGECYKYMKKNYKRSYDYLQKEYGLSITKLVKELLENK
IHLNKDGVQILTNIRIDALKFLAQKTNYDEVKFVSEIQELWKKKKNDVHLFISPGTLEYLRELKNRGYILGAITNGDSDV
NAIKFLNEIFTFVIRSMDYNYSKPSVEIFNIAENLLKRKNLHFGIDQWMHVGDDVYTDIIGAKNKNINCAWITMYRDGNE
VSPNDWYSYLKLKLEKNSDTTLPQYDPFADSLFSRFRKRDVILPYDYIDIEIRHCRDLDAILT

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_091580

General Sub-Cellular Localisation Links