ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_090570 ()

succinyl-CoA synthetase alpha subunit, putative, a gene from Plasmodium knowlesi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10538

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF11_0097 succinyl-CoA synthetase alpha subunit, putative
  • PBANKA_093850 succinyl-CoA synthetase alpha subunit, putative
  • PY05049 Succinyl-CoA synthetase alpha subunit
  • PVX_091100 succinyl-CoA synthetase alpha subunit, putative
  • PCHAS_090580 succinyl-CoA synthetase alpha subunit, putative
  • PKH_090570 succinyl-CoA synthetase alpha subunit, putative
  • NCLIV_042590 2-oxoglutarate dehydrogenase E1 component, related
  • CMU_040940 succinyl-CoA synthetase, alpha subunit, putative
  • TA10625 Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor
  • BBOV_III007780 succinyl-CoA synthetase, alpha subunit family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PKH_090570 succinyl-CoA synthetase alpha subunit, putative
MKSGAIRNWSFSLKGRNFSATSKVFVDKNTTVICQGITGKQGTFHTTEAMKYGTKMVGGVNPRKKGTMWESLDKKYTLPV
FGSTMEAKEKTNCYASVIYVPPEHAKNAIIEAVEAEIPLVVCITEGICQHDMVEVKHCLKMSKKTKLIGPNCPGVIKPGE
CKIGIMPSHIHKKGCVGIVSRSGTLTYEGVNQTTKVGLGQSTCIGIGGDPFHGTNFIDCIKLFLEDDETKCILLIGEIGG
DAEEQVAEWLIQNNVDDGKKKKKPVFAFVAGKCAPPGKRMGHAGALISGGKGTADEKIKALEAAGVHTIMNPALMGQEIY
SIMKDLV

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_090570

General Sub-Cellular Localisation Links