ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_062300 (DBP-1)

erythrocyte binding protein (alpha), a gene from Plasmodium knowlesi

Compiled localisation
microneme

Who localised this protein by microscopy?

Adams, J. H., Hudson, D. E., Torii, M., Ward, G. E., Wellems, T. E., Aikawa, M., Miller, L. H.
The Duffy receptor family of Plasmodium knowlesi is located within the micronemes of invasive malaria merozoites. (1990 Oct 5, Cell) PubMed / full text
   more detail about this publication

microneme
  • "The Duffy receptor family is localized in micronemes, an organelle found in all organisms of the phylum Apicomplexa."
  • Microscopy type:
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_31615

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PKH_062300 erythrocyte binding protein (alpha)
MEGKKKRPLFFLLVLLLSHKANNVLFERMNGILLLECENEYVKNENGYKLATGHHYMDNDQIEQWLQGTDRSRRVKIEEN
VKYKYNVEELNTKYEQMKGKRINRILKESTYEAQNVADNNYIDDKANGEHKTDNKTNKGEGARNMVMLDYDISGSGHPDG
IIDNVVELGTEDEGNFLENSSKGGDHPYRMNRKERMSNGVINQTFLQNNVMDKCNDKRKRGERDWDCPAEKDICISDRRY
QLCMKELTNLVNNTRTHSHNDITFLKLNLKRKLMYDAAVEGDLLLKKNNYQYNKEFCKDIRWGLGDFGDIIMGTNMEGIG
YSQVVENNLRSIFGTDEKAKQDRKQWWNESKEHIWRAMMFSIRSRLKEKFVWICKKDVTLKVEPQIYRWIREWGRDYMSE
LPKEQGKLNEKCASKLYYNNMAICMLPLCHDACKSYDQWITRKKKQWDVLSTKFSSVKKTQKIGTENIATAYDILKQELN
GFKEATFENEINKRDNLYNHLCPCVVEEARKNTQENVKNVGSGVESKAASSNPITEAVKSSSGEGKVQEDSAHKSVNKGE
GKSSTNEADPGSQSGAPASRSVDEKAGVPALSAGQGHDKVPPAEAAATESAVLHSADKTPNTVTEENKEGTQMDGAAGGD
GKAPGPTVSSDVPSVGGKDSGPSTSASHALAGENGEVHNGTDTEPKEDGEKADPQKDIEVKGKQDTDDRSQGSLGPHTDE
RATLGETHMEKDTETAGGSTLTPEQNVSVASDNGNVPGSGNKQNEGATALSGAESLKSNESVHKTIDNTTHGLENKNGGN
EKDFQKHDFMNNDMLNDQASSDHTSSDQTSSDHTSSDQTSSDHTSSDHTSSDQTSSDQTSSDQTIDTEGHHRDNVRNPEI
KSSEDMSKGDFMRNSNSNELYSHNNLNNRKLNRDQYEHRDVKATREKIILMSEVNKCNNRASVKYCNTIEDRMLSSTCSR
ERSKNLCCSISDFCLNYFELYSYEFYNCMKKEFEDPSYECFTKGSSTGIVYFATGGAFLIILLLFASWNAASNDYEEEAT
FDEFVEYSDDIHRTPLMPNDIEHMQQFTPLDYS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_062300

General Sub-Cellular Localisation Links