PKH_051370 ()
14-3-3 protein, a
gene from Plasmodium knowlesi
Compiled localisation
Who localised this protein by microscopy?
No manually curated localisations are recorded in ApiLoc, sorry.
Orthology
OrthoMCL
Part of OrthoMCL group OG4_10210
Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
-
Arabidopsis thaliana- P48347: mitochondrion, cytosol, plasma membrane
-
Arabidopsis thaliana- P46077: cytosol, plasma membrane
-
Arabidopsis thaliana- Q01525: vacuolar membrane, cytosol, plasma membrane
-
Arabidopsis thaliana- Q96300: plasma membrane, chloroplast
-
Arabidopsis thaliana- P42643: nucleus, vacuole, cytosol, plasma membrane, chloroplast, apoplast
-
Arabidopsis thaliana- P48349: cell wall, nucleus, cytosol, plasma membrane, chloroplast
-
Arabidopsis thaliana- P42645: cell wall, mitochondrion, cytosol, plasma membrane
-
Arabidopsis thaliana- P42644: cell wall, mitochondrion, vacuole, cytosol, plasma membrane, chloroplast
-
Arabidopsis thaliana- P48348: cell wall, nucleus, chloroplast
-
Arabidopsis thaliana- P48347: mitochondrion, cytosol, plasma membrane
-
Arabidopsis thaliana- P48348: cell wall, nucleus, chloroplast
-
Caenorhabditis elegans- Q20655: nucleus, cytoplasm
-
Dictyostelium discoideum- P54632: extracellular space, centrosome, phagocytic vesicle
-
Drosophila melanogaster- P92177: nucleus, chromosome, cytoplasm, microtubule associated complex, germline ring canal
-
Mus musculus- P63101: nucleus, mitochondrion
-
Mus musculus- P62259: mitochondrion
-
Mus musculus- Q5SS40: mitochondrion
-
Rattus norvegicus- P62260: kinesin complex, axon part
-
Rattus norvegicus- P63102: soluble fraction, mitochondrion, postsynaptic density, cell leading edge, protein complex, perinuclear region of cytoplasm
-
Saccharomyces cerevisiae- P34730: plasma membrane enriched fraction, nucleus
-
Saccharomyces cerevisiae- P29311: plasma membrane enriched fraction, nucleus
-
Schizosaccharomyces pombe- P42656: spindle pole body, cytosol, cell division site
-
Schizosaccharomyces pombe- P42657: nucleus, cytosol, cell division site, cell tip
Amino Acid Sequence
>PKH_051370 14-3-3 protein
MATSEDLKQLRSDCTYRSKLAEQAERYDEMADAMRTLVEQCVNNDKDELTVEERNLLSVAYKNAVGARRASWRIISSVEQ KEMSKANVHNKNIAATYRKKVEEELNNICQDILNLLTKKLIPNTSESESKVFYYKMKGDYYRYISEFSCDEGKKEASNFA QEAYQKATDIAENELPSTHPIRLGLALNYSVFFYEILNQPHQACEMAKRAFDDAITEFDNVSEDSYKDSTLIMQLLRDNL TLWTSDLQGDQTEEKSKDEGLE
Proteomics
Found in:
Not found in:
Gene-Specific Links for PKH_051370
General Sub-Cellular Localisation Links
-
PlasmoDB:
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|