ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_041310 (MSP-5, MSP5)

merozoite surface protein 5, a gene from Plasmodium knowlesi

Compiled localisation
apical during merozoite

Who localised this protein by microscopy?

Black, C. G., Wang, L., Topolska, A. E., Finkelstein, D. I., Horne, M. K., Thomas, A. W., Mohandas, N., Coppel, R. L.
Merozoite surface proteins 4 and 5 of Plasmodium knowlesi have differing cellular localisation and association with lipid rafts. (2004 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during merozoite
  • "As observed for PvMSP5, the pattern of fluorescent reactivity with antiserum to PkMSP5 was not consistent with the ‘bunch of grapes’ surface rim pattern typically seen with antibodies to other MSPs. Instead, the pattern seen was a single large dot or spot of fluorescence at one end of the merozoite...MSP5 was associated with an apical organelle approximate to the micronemes or over the polar cap "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: H
  • Gene model mapping comments: blast from AY573058, annotation matches
  • Localisation record: apical during merozoite
  • Other genes localised in this publication: merozoite surface protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_57714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PKH_041310 merozoite surface protein 5
MAMARVALAIHLFFLCSYQSGHPLKFSFWREEKIHLQIYTNRLLREEGKNDNVEQMESPSISGTEGKKEIQMISHLQLQS
GKHDQVSFLSANDSNLKGANEEASAESGENGKKSDEENVKKSDEENAKKSDEENKDANSNTKDAESAEGEENPVSQENQM
KTLNNEEDKTNDGKKNGDEEDKKGEKGKDDGKGEEGSEEKMEESAKKEEENTEANKNLESKHAEAEVSEHKQDVTTPEGG
KDSPEGENQKENTPNNTNQENQENADNDENKLHLDKLDDDVPHYSALRNNRVDKGITDSMMLKNIIEDNTKSCSVNNGGC
ADDQICIRINNMGIKCICKEGHLFGGKCILSRSSAINTFFSVGLSVLLAFLWMC

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_041310

General Sub-Cellular Localisation Links