ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_041300 (MSP-4, MSP4)

merozoite surface protein, putative, a gene from Plasmodium knowlesi

Compiled localisation
surface during merozoite

Who localised this protein by microscopy?

Black, C. G., Wang, L., Topolska, A. E., Finkelstein, D. I., Horne, M. K., Thomas, A. W., Mohandas, N., Coppel, R. L.
Merozoite surface proteins 4 and 5 of Plasmodium knowlesi have differing cellular localisation and association with lipid rafts. (2004 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

surface during merozoite
  • "As shown in Fig. 2B, expression of PkMSP4 was localised to the merozoite surface as was to be expected based on previous results with antibodies to PfMSP4 and PvMSP4"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: H
  • Gene model mapping comments: blast from AY573057, annotation matches
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: merozoite surface protein 5

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48471

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PKH_041300 merozoite surface protein, putative
MKVAYFLSALDLLIILNLYLGGTCSDFRSIVGRIRHGRILEDAGDKGSGANDTNNGDTRDNSRPPAENNHSEGGDSTTPP
NDSQKEGAQNILPGNAGEAGNHNVEEPNEDYDAHDDEYYNNVEDDESYDLKDHNENLCSENNGGCGNDKICENIGDGIVK
CLCKPGYKLVGTECVEASKSSSLNSVFCWFLLLIIVLASIN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_041300

General Sub-Cellular Localisation Links