ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PKH_040760 (SPATR)

SPATR protein, putative, a gene from Plasmodium knowlesi

Compiled localisation
surface during blood stages and sporozoite

Who localised this protein by microscopy?

Mahajan, B., Jani, D., Chattopadhyay, R., Nagarkatti, R., Zheng, H., Majam, V., Weiss, W., Kumar, S., Rathore, D.
Identification, cloning, expression, and characterization of the gene for Plasmodium knowlesi surface protein containing an altered thrombospondin repeat domain. (2005 Sep, Infect Immun) PubMed / full text
   more detail about this publication

surface during blood stages and sporozoite
  • "By immunofluorescence analysis, we determined that PkSPATR is a multistage antigen that is expressed on the surface of P. knowlesi sporozoite and erythrocytic stage parasites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: New rhesus monkey isolate
  • Gene model mapping comments: blast from AY952327, annotation matches
  • Localisation record: surface during sporozoite and blood stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_38860

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_030950 secreted protein with altered thrombospondin repeat domain, putative
  • PY02991 putative secreted protein with altered thrombospondin domain
  • PVX_002900 hypothetical protein, conserved
  • PCHAS_031160 secreted protein with altered thrombospondin repeat domain, putative
  • NCLIV_000860 SPATR, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PKH_040760 SPATR protein, putative
MKKSRFFFVSIFFYLSQESSLELSKKLSGANSSLTEHDEDDYEHAHKRPRTWSADSTPEVDGDMCVIFSASEGDPTNCWC
PRGYIMCSEEDVRDVQSKLYEIKDLKQRNEVTPPWMKRLCDNSEEIGFKSMSVVIDYELAVLCNDGHEKGNADFKIIGAS
GFVPNEKIIQQKERDITYVPRKCTVNNFYLCRKVEDDNVGCQFSPWSPWGPCVNNKQRRTRKVMRSNQNNENFCLWNGKR
IPRSIIEDTRPCKIALEATNQN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PKH_040760

General Sub-Cellular Localisation Links