ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AF064079.1 (CHT1)

gi|7530423|gb|AF064079.1| Plasmodium gallinaceum endochitinase precursor, mRNA, complete cds, a gene from Plasmodium gallinaceum

Compiled localisation
microneme lumen and not surface during ookinete
microneme during mature ookinete

Who localised this protein by microscopy?

Li, F., Templeton, T. J., Popov, V., Comer, J. E., Tsuboi, T., Torii, M., Vinetz, J. M.
Plasmodium ookinete-secreted proteins secreted through a common micronemal pathway are targets of blocking malaria transmission. (2004 Jun 18, J Biol Chem) PubMed / full text
   more detail about this publication

microneme lumen and not surface during ookinete

Langer, R. C., Hayward, R. E., Tsuboi, T., Tachibana, M., Torii, M., Vinetz, J. M.
Micronemal transport of Plasmodium ookinete chitinases to the electron-dense area of the apical complex for extracellular secretion. (2000 Nov, Infect Immun) PubMed / full text
   more detail about this publication

microneme during mature ookinete
  • "Longitudinal section of a maturing ookinete in which PgCHT1 is associated with micronemes (mn) at the apical third of the parasite (arrow)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: AF064079.1 taken directly from publication
  • Localisation record: microneme during mature ookinete
  • Comment: strain information not available online
  • Comment: genbank not available, but sequence is available from http://www.pnas.org/content/96/24/14061.full
  • Other genes localised in this publication: chitinase

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AF064079.1 gi|7530423|gb|AF064079.1| Plasmodium gallinaceum endochitinase precursor, mRNA, complete cds
MNFKISIFLIIVSILYSANSRTLKGKNNINNSLGIIRENKNKTHQTEIHESFSHLKSNNSNFVEYGSYCGDGCNSRITKN
NKNINKNDRKSPRQILEEYKKRKQGIIAGYYGSWNSQGDRAKHMIDSNPMVSILYIAFARINMLYDVSRPFNGRQRFLLR
KHGLEYETYGMMLNEIRRIRKVRPDVIILLSLGGETYMIDIEKEIDYVDKILKLVNDFDLDGVDIDWEPHGKFYNLNELN
FSNYYIKLINLLRKTIPEEKLISISGSSNAALSCVSGVASFCKDEESPYNTKFLSEQIETNKELHRAAAMLSAGTFINIF
NTAKEKIDLVFIQTYNLETTNPDIMVDMYLSHLYFGLKYNITIILGFSLEHNRGGFSPENKELLELVGKTIHDKNQNNNR
ADGIGIWHLFMKEQLPTGSFDVDIFLTNIWKHLNPEVQTPKDLTITENPEDCSTIDEYVPGLVIPTIGIYYKHNDAIWKT
RSYSIHAPGVDRYEWDLVKVCYEKICDGKAAHYYNTDYKESSIIIWKGEPYLIKWWQQGPPEGQALESYTKLDASKCPGI
EEWNKKYPHKPLEVEEQYEQEVDLPLQ

Proteomics

Found in:

Not found in:

Gene-Specific Links for AF064079.1

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins