ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AB247370 (CTRP)

gi|110681633|dbj|AB247370.1| Plasmodium gallinaceum pgctrp gene for circumsporozoite protein/thrombospondin-related anonymous protein-related protein, partial cds, strain:7A, a gene from Plasmodium gallinaceum

Compiled localisation
microneme membrane and microneme and sub-pellicular region at the anterior during ookinete

Who localised this protein by microscopy?

Kaneko, O., Templeton, T. J., Iriko, H., Tachibana, M., Otsuki, H., Takeo, S., Sattabongkot, J., Torii, M., Tsuboi, T.
The Plasmodium vivax homolog of the ookinete adhesive micronemal protein, CTRP. (2006 Sep, Parasitol Int) PubMed / full text
   more detail about this publication

microneme and sub-pellicular region at the anterior during ookinete
  • "The immuno-gold particles associated with micronemes and the subpellicular region at the anterior portion. "
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain:
  • Gene model mapping comments: AB247370 taken directly from publication
  • Localisation record: microneme and sub-pellicular region at the anterior portion during ookinete
  • Comment: strain information not found
  • Other genes localised in this publication: ookinete protein-related, CTRP adhesive protein (invasive stage), putative

Li, F., Templeton, T. J., Popov, V., Comer, J. E., Tsuboi, T., Torii, M., Vinetz, J. M.
Plasmodium ookinete-secreted proteins secreted through a common micronemal pathway are targets of blocking malaria transmission. (2004 Jun 18, J Biol Chem) PubMed / full text
   more detail about this publication

microneme membrane during ookinete

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AB247370 gi|110681633|dbj|AB247370.1| Plasmodium gallinaceum pgctrp gene for circumsporozoite protein/thrombospondin-related anonymous protein-related protein, partial cds, strain:7A
MKKAFVLIFSCLVLFLHFNIVKTESNKDESFHHDKLINKNHIKSKNADYSKKKTFLQFKATANEAPCIGYECFCMNYYDL
TLILDESASIKLDNWVNKVVPFTSEIIENLSISENEVHVGIVLFGIKSRDYVKFNENIKYKKEDLLKKVDKLKSNYGNVG
GTYIIKALEYSMKNYTKNKNSRPDAPKVTILFTDGNDNVAKDKQLYDTGLSYRKENVKLLVIGVSKAIHNKLKLIAGCEI
NDSCPFAMKVEWANLNDITKLLTDKICNTGPITDPKPDHKPCNGDECFCDDYYDLTLILDESASIGSKKWKSDVVPFAEE
VINNLSISKDKIHAGVMRFAIYMKTDVSYDQEARYMKNDLIKIIRGLKDKYGNGGGTHIVEALEYSLTNFTKHPNNRIDA
PKVTILFTDGSENSRPISAVRDIGLLYRRENIKLLVLGVHSVDINNLKLLAGCKENTDCPFAMKAEWDELKNISKIFTDK
ICNTGPVQNPDLELPVSPPNFTPCSKPQDCYCMDFYDLTLVLDESASISDYRWKKEVVPFSEELIKNLNISFSKIHVGVM
LFAEYNREFVRFSDKVSYEKENLQKKIKELQGDYIRGKKSHIINALSYALTYYSKYPGRPEAPKVTLLFTDGYDSDQSDE
ELYNVGLLYRKNNVKLLVIGVSMANENKLKLLVACNQTGPCPYVIKTEWINLKSLPKAMIEKICVTGPVLPPHINPPTLC
KGDECFCHNYYDLTLILDESASIGHINWKEQVAPFTEEIVKNLKVSENEVHIGIFLFAQFNRDFVKFSEEESYKKNILTQ
KVENLKNDYKEGGYTYIVEALEYGLQNYTKDPSSRSDASKVTILFTDGNNTNPSEDILINISSMYKNEQVKLLVLGVGNA
TIYKLRLLGGCHKTNGDCPTAIKIDWNNLKDISALMIDKVCNTDKPSTIPQTCVGDECLCKDYFDLTFIGVPSKQGNNKL
SSDIIPYAEHIINSFNIDEQHVHVAISIYLGSKTIQIGFDDVNSYNKKELLMKIRKMDNIYAMSKTNIAHALEMGLKQSF
GNGNREKAPKVTLLLTNSDNDISEEGILQQVSNNYIDKQVKLIIIGLGKLLIDKLIIAGGCSLNYNNCPNVLQSTDSSFF
SEVEDFLKENICNNNVDPVIPPAFSCDDPLCEECDDDLCDNNTLCKKALDIAIVLDQSRNISNEQWKTYVKPFAINTVKQ
NYLSKYRTHITIVKMRKHTKEKWSLNKKISYKKNKIIKKINKLLMSPSNYKNIADTFKHLRTKVFTKTPKYKKKLIIMLV
EGKSNTSLNDLRREIELLKINKIDLFVYAINNIDDNEYKILGNCEKSTLCENIVKVSWDSLLSDSDTHMNYICNNYPDDA
ECNEWDEWSKCPETCDNAMSKRERKGPYTLKGEGFIGEKHGNSCIELGSLEYRPCPIKEGCNDICGDFGEWSQCSATCGD
GIRIRERENSLDSEECKIFNKTEIESCNIQDCDNSEICEEIGEWGEWSSCSKTCGYSTKERMFIILPEYVDKYPDCKYKE
QVEIDVCSVPKCDDEKCFEWGIWGEWSASCGQRKRVQRANLNIDLSNINYEDTKSNECKEYYRDKVEYDETIPCPGNSCG
NWTEWSTCDRTCNVGVRMRHFVSHVSGISGDDIDECIEQYNDIETEACLDLPLCDTGDCDDWETWIDCKEEDTCHKSSKR
ILTRKAELLNNKKKNTSEFCNDFKLFREEECSESNKPCNDALCNEWEEWGDCSATCGTSFKIRKRKEPLELIPPSKDING
NMGLTCEQQNIKIEEREACDTSVCSSIINDTPNGTHPNEGENKDDSNKKKGFGTGEKVSLAAGVIGLIALATGGLIYGYN
TFNGGEIPDNSNMEFENVENNVGEVDETNEDFEVI

Proteomics

Found in:

Not found in:

Gene-Specific Links for AB247370

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins