ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL2510w (CHT1)

chitinase, a gene from Plasmodium falciparum

Compiled localisation
zygote remnant during ookinete retort

Who localised this protein by microscopy?

Langer, R. C., Hayward, R. E., Tsuboi, T., Tachibana, M., Torii, M., Vinetz, J. M.
Micronemal transport of Plasmodium ookinete chitinases to the electron-dense area of the apical complex for extracellular secretion. (2000 Nov, Infect Immun) PubMed / full text
   more detail about this publication

zygote remnant during ookinete retort
  • "Confocal immunofluorescence microscopy of immature P.falciparum ookinetes stained simultaneously with mouse anti-P. falciparum chitinase (PfCHT1) MAb 1C3 (green) and rabbit polyclonal antiserum to a recombinant P.falciparum zygote-ookinete surface antigen (Pfs25-Pfs28) fusion protein (8) (red). The surface of the parasite is delineated by rhodamine staining of surface proteins Pfs25 and Pfs28. Staining with MAb 1C3 demonstrates the granular appearance of PfCHT1, which is most concentrated in the zygote remnant but also appears to be present anteriorly as well, reaching near the apical end."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from AF172445
  • Localisation record: strong zygote remnant during ookinete retort
  • Comment: blasting the nucleotide sequence of AF172445 doesn't appear to work, but the protein sequence matches perfectly
  • Other genes localised in this publication: gi|7530423|gb|AF064079.1| Plasmodium gallinaceum endochitinase precursor, mRNA, complete cds

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24228

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL2510w chitinase
MNFTVKYSFLVICLLCCLLSTYVSVIEGHRARPGESRKNPREIIKTFKESGKGIIQGYYPSWVSYNHNLKDLNPNLNVVH
MSFAKMDLSYDSIESIVGSPLLFKSLIGLEYIGLNEYFNDAMNLRKARPDIIMLLSLGGETYHPSSFDSALNAVEKIANL
VDELGFDGIDVDYEPNGSFDGLNDKEKADFFVQYVTKLREYMCDDKLISISQSSNGALSCIGFNDPKKICMDDEAPYNSK
YFNKPDVKKELLRAAQMASAGGAIYLMNNLKDMIDMVFVQTFNYTNSTDSTVMKELYDSYAYYGKKYDYVIIMGFTLMFP
STPFNPNDKMLVKSIGDFVKTENKLNKRADGFGLWSLSSDNAAHNEQLAIEYFVESLH

Gene-Specific Links for PFL2510w

General Sub-Cellular Localisation Links