ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL2405c (g377)

osmiophilic body protein, a gene from Plasmodium falciparum

Compiled localisation
osmiophilic body during female gametocyte and gametocyte and male gametocyte
during female gametocyte stage iii and gametocyte stage iv and gametocyte stage v

Who localised this protein by microscopy?

Reininger, L., Tewari, R., Fennell, C., Holland, Z., Goldring, D., Ranford-Cartwright, L., Billker, O., Doerig, C.
An essential role for the Plasmodium Nek-2 Nima-related protein kinase in the sexual development of malaria parasites. (2009 Jul 31, J Biol Chem) PubMed / full text
   more detail about this publication

osmiophilic body during female gametocyte and male gametocyte
  • "Furthermore, counter-staining gametocytes expressing GFP-tagged Pfnek-2 with an antibody against the female-specific antigen Pfg377 revealed that all (100%) of the green fluorescent parasites were Pfg377-positive, as shown by the well-documented punctate pattern of red fluorescence associated with the osmiophilic bodies, to which Pfg377 is known to localise."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: osmiophilic body during male gametocyte and female gametocyte
  • Other genes localised in this publication: NIMA related kinase 2

de Koning-Ward, T. F., Olivieri, A., Bertuccini, L., Hood, A., Silvestrini, F., Charvalias, K., Berzosa Diaz, P., Camarda, G., McElwain, T. F., Papenfuss, T., Healer, J., Baldassarri, L., Crabb, B. S., Alano, P., Ranford-Cartwright, L. C.
The role of osmiophilic bodies and Pfg377 expression in female gametocyte emergence and mosquito infectivity in the human malaria parasite Plasmodium falciparum. (2008 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

during gametocyte stage iv and gametocyte stage v
  • "Immunofluorescence analysis was conducted on acetone-fixed smears of parasite cultures containing gametocytes mostly at stages IV and V of maturation (Fig.2). .. In contrast anti-Pfg377 antibodies stained gametocytes of the wt clone only and not those produced by the pfg377 clones."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during stage IV gametocyte and stage V gametocyte
  • Other genes localised in this publication: -

Silvestrini, F., Alano, P., Williams, J. L.
Commitment to the production of male and female gametocytes in the human malaria parasite Plasmodium falciparum. (2000 Nov, Parasitology) PubMed / full text
   more detail about this publication

during female gametocyte stage iii
  • "However, the vast majority of gametocytes, 1623 (94n9 %), were stained in a mutually exclusive fashion by only 1 of the 2 sex-specific antibodies: 1504 reacted only with anti-Pfg377 antibodies, and were classified as females, and 119 reacted only with anti--tubulin-II, and were classified as males. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: NF54
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during stage III female gametocyte
  • Other genes localised in this publication: alpha tubulin 2

Alano, P., Read, D., Bruce, M., Aikawa, M., Kaido, T., Tegoshi, T., Bhatti, S., Smith, D. K., Luo, C., Hansra, S., Carter, R., Elliott, J. F.
COS cell expression cloning of Pfg377, a Plasmodium falciparum gametocyte antigen associated with osmiophilic bodies. (1995 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

osmiophilic body during gametocyte
  • "The Pfg377 gene resides on chromosome 12, and immunoelectron microscopy with two different anti-Pfg377 polyclonal antisera raised against two separate recombinant sub-fragments of the protein both indicated that the antigen is located in electron-dense organelles of the gametocytes--the osmiophilic bodies--which are proposed to play a role in parasite emergence from the erythrocyte during gametocyte maturation in the Anopheles mosquito midgut."
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Blast from L04161, annotation matches
  • Localisation record: osmiophilic body during gametocyte
  • Other genes localised in this publication: 6-cysteine protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_35148

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL2405c osmiophilic body protein
MKLLLFFFISSIFLQLTSGKRILNFDNIIKHLKESKLLPEDIPHVLENDIIIVPPYLIYKYKGKIYHLHNNVDLTLINHP
EEDSCDKEEIWESPFPPKVPEPERPHEPEMEPQVEPEPGPLPEEVREPEPEPEAEPEKELEMEEQEEVIEADMVLDEETG
IKIPKKTEQDVLEVSKFREEYELPNVVELTPEEKEKNNILHFAGNKSTAFNLKEIINYKKDESLMNSLSSSFDHFYTPNV
EERNLSNAYNVDINDYYDLLRALHILCKDEDNKLYTINRIPKDELLFFLKHAYVNIYNSLKKYILLNGYNFEDYIYTSEN
FTLDQIFKDYFFLSNDDTNENGSFNNIIESIKYIKKAIEKLNVKRIEEKIKYFFQIYEVHAFDFKLLHYIFSRNQLLNYS
EDDLIHHAVDIMNITRIDISPRVISALFMYFLNKVNIFLVPQYVTRNRNDFTLLLEHNDLLLRTEIIYRDFLKHFFKHKT
PHVHLKKNNHDNAYQLVPWSQVLFSEFNSTYDFLNFKYMIILFHDSYHAFVDYFEGDDKLNQVLNDNKENKTIDNLDKFF
NELLNLFLIENVGILSTLEEYFVSTVKQVGRVLSDDHDIDSKEYTENYFTPEEEEQALKDFKEDEASVHHLDHYDNNMDP
YYEYQGEFGSYEEEEDELRKFKEDEPEPWPLDESPHIEHGTLHDDELNPFQEEKKDDESFYTSEDEDTLDHSHEKEDDVS
HPEHEDHNEGYIPHTYDDDSFFTDEEDDEGDEVNEENVPLNHEEENVPLNHEEDNFPLNHEEDNFPLNHEEENVPLNHEE
ENVPLNHEEENVPLNHEEENYNSFLSYQKYDERDISPHNVNQHKKEIFHHRNITPYHVNHHNQHMDQHDHHIDHHNHHID
HHNHHIDHHNHHIDHHNHHIDHQDHHIDHHNHHIDHHNHHIDHHDHHIDHHDHHIDHHNHHIDHKSNNQFLQKHQNYVRG
HSSFITISEGEENHDNRELRKKIEANLKEEWKKRFNEQQEQRERKKKAEEDEMNETIQKHDMETSKLEKKEEVDEVTQDE
EFDKQYAIDDQEELEFLRTRDSEGSESDVPKDKVKPFPDGRSPDSFYYNTAISSFHEKMEELYNTSISSSLNYVKEINRK
FDDVYKELKSKTYPKFDDLTSQTKTNCNKLFQKLNETIKDKEYQKNIQSYKNKVIDILDDIQKKANGKYIIIQNLIIEKI
DIYKGDVVRLSDRKFYKNFRKVLGKRKMKMLEDFRAQFKGAIRFIKDLTTTYMEEEYTKVLEDIYMEKKKYYKEEYSKMR
RIISSNLDYEVNKQIKEHYHKVDTISEHKFQEIRQHMRDKIENTIHELYKEMYVQIQIDLTNYYHQLENIHSELLQALQQ
NKNIPRHLNVLEKKLEITKRKKKNKPDISTSSHATDEQQVSDTLIRGAHNHGDIIKGEDNDEVLLIEQIQSLKTKMGDNQ
NQVGSILEKLNNLSDQYQLLQDKLNVVEDIYKNLRNFKHYIEKLHKESKINREKFITKVDVLSNVYSTLEYMVKFLLHDF
QEWSFEKDELEKHLYELEERKKYITLEIQIRDTLSTNIQNGEGDHINNNNNNNNVRNNLKKQVLKDLDLEISKLKGHILE
VDIKKNIALEQINYLTNNTNETVPDVIRDLMPAPRIVPVSEDIYDYITWVRDNTAVINNTLRHFVMTFDQKIYDYDDHLI
FVYNIKELIYKENLADEKYNANYYYEMNRFYLHLEEFFYILKHYVELRKIQDLGEVAIPSFEENIKTKGSLIDVHQKDKD
GTQIIEYLERNVLHIYSILRNIKNNNIHLYHYLVPDLSNILIDPEEFKKMSNGEQPELNKLHKYLLDAYTNLKKEGQVVD
QIYVEYINFHNHFEHTYDKLLWYKTILKRYIERSKKIYEKSYGTYTVSHIQLYDNKKDGHDNHHDQHHDNHHDQHHDHHH
DQHHDHHHDHDQHHNNNYNYNNISFLRSFVQLNYHNTLHERSDHIFLKSPILLQYDPEKIVESNEKRHIRVIRDQNNFPY
KLGEVKETYVLNKSIHDKFVKSKKLDEYKKYMNNKLYDIVHEHKRGKGKLYLFEKEELEKYQLIFGGKTLIKGSLLNFLS
HININLNKNLLINQINDTINEYLKKRNLSYNSIIELIKYLQKNPSVIHFIDLIKLGKNILERSNVLYIKKEWFTLYLYTL
LELLGIEVNMEHVDVHEERGLKNEHNNYISEKSYALHYLYVLRNYNKRIEIKNQIQNYVLQFLLPEHKFDMEDYQPILYE
FLKAINDSMDGDSITYNEFKKKNPEVYTTLVSVIKKGIEDFFYTMFNKIIEEHPELKEEIYFDDNYNDEEKDRFRYANYT
WERANLNEILTLYFYVLNPGLRNVIYKHFIKVNIKCLKDYKNFDFKEIFSFLNYDDIGATFLNYLKEHELFEIPPLIIFL
RFFFHEKNEELFTFNSIRYKINSYFEGKSLDRKTKEMIARLVYSFFMRISYLSVSYFDHDIFKIINKSDLNIIILFHTII
NKINYLLYCGTEKLFIERYAPTNLFVQNRIFKIDAVKVFHHFIYSLPPYMRNVVFHFFKSNQFIDVTKKLIIKFLQHSHS
LLDITNHKDGHFYQLKNNTYKLETFLFSWKYNFTKNKNIIEPTFTKFIENKPVFKNMPLLYNRRIKYDSINEKLQYKEEL
DLHDMIDNESFHQLLDLLNKESITLEQLSFLFSRYITEHANIKDFPKLFMFKKYVTYVQDEKFFINLYEYLYNYLHKEFG
LPQPIYELYYVFIKTFIEYILLPEKLTQEEKSQNVLNYDLQNKYMNFHHFVQKLCSCLFNFYYYDEIYECQPFGFFTKEE
FSYEQQIFNILQQPFINISPIIKHNYIHDDYYMYEKDLNGNYLSSNINNNNNNNNINNIDSNYVNRRDKNGDYIHGTNIN
SDILYHFIKQYIPLVEPSDEEHLQIEVFKFKYFTLEITKFVLRHILKKLPFNYLIHMNWNDTYIHIDHIINNLFLHFFKK
NKAHLLQQNQLQGLTHKINFENNLGKDHTKDEYLSKHIPQSAQNYDRNKFSGTINNLLKDPNNLPPTYRHIKYYMDHYIL
QYSLHNHMLFKYLHNIFQHIDQYKTYFPTLAELYLYIDKRVTIINVINNSFLYKRIHTRDVIHTFLLLCHEIGLDLYEL

Gene-Specific Links for PFL2405c

General Sub-Cellular Localisation Links