ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL2210w (ALAS)

delta-aminolevulinic acid synthetase, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during intraerythrocytic and schizont and trophozoite
not apicoplast during schizont and trophozoite

Who localised this protein by microscopy?

Nagaraj, V. A., Prasad, D., Arumugam, R., Rangarajan, P. N., Padmanaban, G.
Characterization of coproporphyrinogen III oxidase in Plasmodium falciparum cytosol. (2010 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

mitochondrion during intraerythrocytic
  • "The results presented in Fig. 4 indicate that the PfCPO signal was distributed throughout the parasite, but did not colocalize with that of Mitotracker dye (mitochondrial marker), PfALAS (mitochondrial marker) or PfUROD (apicoplast marker)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrial during erythrocytic
  • Comment: strain information not found
  • Other genes localised in this publication: coproporphyrinogen III oxidase, uroporphyrinogen III decarboxylase

Nagaraj, V. A., Arumugam, R., Gopalakrishnan, B., Jyothsna, Y. S., Rangarajan, P. N., Padmanaban, G.
Unique properties of Plasmodium falciparum porphobilinogen deaminase. (2008 Jan 4, J Biol Chem) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during trophozoite
  • "This laboratory has shown earlier that PfALAD is localized to the apicoplast (12), and PfALAS is localized to the mitochondrion (11)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria and not apicoplast during troph
  • Comment: strain information not found
  • Other genes localised in this publication: porphobilinogen deaminase, delta-aminolevulinic acid dehydratase

Sato, S., Clough, B., Coates, L., Wilson, R. J.
Enzymes for heme biosynthesis are found in both the mitochondrion and plastid of the malaria parasite Plasmodium falciparum. (2004 Mar, Protist) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during schizont and trophozoite
  • "The resulting construct for an ALAS-GFP fusion protein was recombined into the malarial expression plasmid pSSPF2 (Sato et al. 2003). In transfected parasites, the signal observed for GFP co-localized with the mitochondrion-specific dye MitoTracker Red."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Blast from AAN36526, annotation matches
  • Localisation record: Mitochondria and not apicoplast during troph and schizont
  • Other genes localised in this publication: delta-aminolevulinic acid dehydratase, porphobilinogen deaminase, stromal-processing peptidase, putative, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10268

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_145920 delta-aminolevulinic acid synthetase, putative
  • PY05459 delta-aminolevulinic acid synthetase
  • PVX_101195 5-aminolevulinic acid synthase, putative
  • PCHAS_146150 delta-aminolevulinic acid synthetase, putative
  • PKH_146340 delta-aminolevulinic acid synthethase, putative
  • TGME49_058690 5-aminolevulinic acid synthase, putative
  • NCLIV_027820 5-aminolevulinic acid synthase, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL2210w delta-aminolevulinic acid synthetase
MRKKRTLKVSINEIKKYCPFVKNIQFLYNTNEKKNNLVLSVMSDLCPVGKAINEKHFIIIDNKSKINIIKILKQANMQSK
VLVQCIKNKNIEKENMSNDDLLKSGKRNNNVLFYDILEKNKNDHSFQINDNTIQKNNIIYKYINSLDEYKLFKNNCNNNL
KDLLNKLYTDKRYRIFTILNKYRINYPNVYIENNKLMLPSFYEFYQKYGYKPCIGNIRYQLSASFEDNNKNICSFSHKNK
ENYLFNFWNLHIDNVSNEKTVVWCSNDYLCLSNNEKIIEVGIETLKKIGNSSGGTRNISGSLLNHTHLEYIIAKWYNKES
SLLFTSGYIANVGALETLGKLLNLIYISDEMNHASIINGIRESRCEKFIFKHNDMNDLERILYNLRINKQYENRKIMIVF
ESIYSMSGHISNIEYIVQLAKKYNALTYVDEVHAVGLYGNKGSGYLEELHLCNHIDIINGTLSKAIGSLGGFICANKYYI
DVIRSYSSHFIFTTSLTPVNINTSAEAIHIIQNDMSLRKKLTQVVNKTKQKLQERGIQVLHNNSHIVVLMINSAEKCKQI
CDDLLKEYNIYIQPINYPTVPMGMERIRITPSPFHTDEQIFKLVNSLYTLFKKYQVNMFDKKNKHTLMKL

Gene-Specific Links for PFL2210w

General Sub-Cellular Localisation Links