ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL2100w ()

ubiquitin conjugating enzyme E2, putative, a gene from Plasmodium falciparum

Compiled localisation
non-invasion-related localisation and not apical and not inner membrane complex and not merozoite surface during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

non-invasion-related localisation and not apical and not inner membrane complex and not merozoite surface during extracellular merozoite and late schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14258

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_145700 ubiquitin-conjugating enzyme, putative
  • PY01211 ubiquitin-conjugating enzyme e2-17 kDa
  • PVX_101085 ubiquitin-conjugating enzyme domain containing protein
  • PCHAS_145930 ubiquitin-conjugating enzyme, putative
  • PKH_146080 ubiquitin conjugating enzyme, putative
  • TGME49_064050 ubiquitin-conjugating enzyme domain-containing protein
  • NCLIV_024020 ubiquitin-conjugating enzyme domain-containing protein, putative
  • cgd2_240 ubiquitin-conjugating enzyme
  • Chro.20031 hypothetical protein
  • CMU_010170 ubiquitin-conjugating enzyme family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL2100w ubiquitin conjugating enzyme E2, putative
MWYDNERIVEEEGISRLLVGRTFAYFPKYVDGKNNSISSESKENLDSIDNITYDNKEYVLITQRLGRTIIPLNPELLAQS
TFDQDIIDGYLNEIHKNVHNYSILTEYSFLMNEIPRNFYCLPQIDNLLIWDVFIMLYSTVYKNAKLKLQIRLSHNYPNTC
PEVFFITPIFHPLVNIQTGKLNLGTSLSNWDPSCHYMSLIFLYIKNLFYLQEEYNKETVENQEALFLLNNDKDEFIKNVQ
KYINQGNKKIYDHMENCMFNFNQKEEHIEIKDKLENIKTDQVCARKAEAFVHWLINEYSMENTNGDGDTTNEDDNNINGD
DNNINGDDNNINGDDNNINGDENSINGYENNINGDENNINGDDNNINGDDNNINGDENSINGYENNINGDDNNINGDENN
INGDDNNINGDDNNINVDENNINEDENNKENIKRDDTNEEYNQNDNINVEKYSMDNYINNVSTNE

Gene-Specific Links for PFL2100w

General Sub-Cellular Localisation Links