ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL2085w ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and late schizont

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PFL2085w conserved Plasmodium protein, unknown function
MFPSFNNPYFNINKKCLQKENRIDMNPNKVEGTEVTNELYLQFQNEINIFINCINGHEKKNKEINYVETSHVMTGSEDEF
IFYLRNIQDNQEKEKNRKEKQLHSNIINYSEYNKNYTTTQHIWNGGDIEKKQKKKKKNYSSNSMKKYNINKNNENIIFEN
MLNKNEEILNHKISEIIEFGKKRNDPNIYNRANKNIYTYLKNCNLKGYENGYMNISENYNDHNNINIYNCEEEDDIWNTF
MFTRNDSKDSKMIIANFINRIKDSKQEQNNEDMMLKKYTHKKKKKNSYQSICNNYTEHLNFKNINMENEQKISFSNYNNQ
SNVFKEYEKIVKKNEEILILLYKIIYKLNIFDINKKFNKKIEDVVNIYIIKVNNIISTYKLLLQYDNIQRRKLLEYYFKK
NEIMLLKNILKYIIQLMSEIKHQYSGIKKQIQKKIMEIQKVAS

Gene-Specific Links for PFL2085w

General Sub-Cellular Localisation Links