ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1960w (EMP1)

erythrocyte membrane protein 1, PfEMP1, a gene from Plasmodium falciparum

Compiled localisation
maurer's cleft during intraerythrocytic and trophozoite
erythrocyte cytoplasm during trophozoite
erythrocyte plasma membrane during intraerythrocytic

Who localised this protein by microscopy?

Kulzer, S., Rug, M., Brinkmann, K., Cannon, P., Cowman, A., Lingelbach, K., Blatch, G. L., Maier, A. G., Przyborski, J. M.
Parasite-encoded Hsp40 proteins define novel mobile structures in the cytosol of the P. falciparum-infected erythrocyte. (2010 Oct, Cell Microbiol) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane and maurer's cleft

Jackson, K. E., Spielmann, T., Hanssen, E., Adisa, A., Separovic, F., Dixon, M. W., Trenholme, K. R., Hawthorne, P. L., Gardiner, D. L., Gilberger, T., Tilley, L.
Selective permeabilization of the host cell membrane of Plasmodium falciparum-infected red blood cells with streptolysin O and equinatoxin II. (2007 Apr 1, Biochem J) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane and maurer's cleft during intraerythrocytic
  • "The K119-PfEMP1-GFP chimera contains a fragment of the major virulence factor of P. falciparum (PfEMP1) that is directed to the Maurer's clefts and the host cell membrane [21]."
  • Microscopy type: live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Clefts and host cell membrane during intraerythrocytic
  • Other genes localised in this publication: circumsporozoite-related antigen, ring-exported protein 3

Spycher, C., Rug, M., Klonis, N., Ferguson, D. J., Cowman, A. F., Beck, H. P., Tilley, L.
Genesis of and trafficking to the Maurer's clefts of Plasmodium falciparum-infected erythrocytes. (2006 Jun, Mol Cell Biol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm and maurer's cleft during trophozoite
  • "We also examined the profiles of cells labeled with an antiserum against the cytoadherence antigen, PfEMP1. This protein is exported to peripheral Maurer's clefts (Fig. 5c) prior to redistribution to the RBC membrane (Fig. 5c, blue arrow)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: maurer's Cleft and RBC Surface during troph
  • Comment: strain information not found
  • Other genes localised in this publication: membrane associated histidine-rich protein, ring-exported protein 1

Marti, M., Good, R. T., Rug, M., Knuepfer, E., Cowman, A. F.
Targeting malaria virulence and remodeling proteins to the host erythrocyte. (2004 Dec 10, Science) PubMed / full text
   more detail about this publication

erythrocyte plasma membrane and maurer's cleft
  • "Export of PfEMP1-YFP also depends on a functional Pexel motif. As for the Rifin-YFP fusion, the reporter transiently localizes to structures similar to Maurer's clefts, followed by a rim fluorescence suggestive of surface localization."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication, annotation matches
  • Localisation record: mc and erythrocyte membrane
  • Other genes localised in this publication: glycophorin binding protein, knob-associated histidine-rich protein

Wickert, H., Wissing, F., Andrews, K. T., Stich, A., Krohne, G., Lanzer, M.
Evidence for trafficking of PfEMP1 to the surface of P. falciparum-infected erythrocytes via a complex membrane network. (2003 Jun, Eur J Cell Biol) PubMed / full text
   more detail about this publication

maurer's cleft during trophozoite
  • "Here we present evidence for a continuous membrane network of parasite origin in the erythrocyte cytoplasm. Co-localizations with antibodies against PfEMP1, PfExp-1, Pf332 and PfSbp1 at the light and electron microscopical level indicate that this membrane network is composed of structures that have been previously described as tubovesicular membrane network (TVM), Maurers clefts and membrane whorls. "
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Maurer's Cleft during troph
  • Other genes localised in this publication: antigen 332, DBL-like protein, circumsporozoite-related antigen, skeleton-binding protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11262

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL13P1.1 erythrocyte membrane protein 1, PfEMP1
  • MAL13P1.356 erythrocyte membrane protein 1, PfEMP1
  • MAL13P1.6 erythrocyte membrane protein 1-like
  • MAL7P1.183 erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • MAL7P1.186 var-like erythrocyte membrane protein 1
  • MAL7P1.187 erythrocyte membrane protein 1, PfEMP1
  • MAL7P1.212 erythrocyte membrane protein 1, PfEMP1
  • MAL7P1.214 VAR pseudogene fragment, erythrocyte membrane protein 1 (PfEMP1) pseudogene fragment
  • MAL7P1.50 erythrocyte membrane protein 1, PfEMP1
  • MAL7P1.55 erythrocyte membrane protein 1, PfEMP1
  • MAL7P1.56 erythrocyte membrane protein 1, PfEMP1
  • MAL7P1.61 erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • MAL8P1.207 erythrocyte membrane protein 1, PfEMP1
  • MAL8P1.209 var-like protein
  • MAL8P1.220 erythrocyte membrane protein 1, PfEMP1
  • PF07_0048 erythrocyte membrane protein 1, PfEMP1
  • PF07_0049 erythrocyte membrane protein 1, PfEMP1
  • PF07_0050 erythrocyte membrane protein 1, PfEMP1
  • PF07_0051 erythrocyte membrane protein 1, PfEMP1
  • PF08_0103 erythrocyte membrane protein 1, PfEMP1
  • PF08_0106 erythrocyte membrane protein 1, PfEMP1
  • PF08_0107 erythrocyte membrane protein 1, PfEMP1
  • PF08_0140 erythrocyte membrane protein 1, PfEMP1
  • PF08_0141 erythrocyte membrane protein 1, PfEMP1
  • PF08_0142 erythrocyte membrane protein 1, PfEMP1
  • PF10_0001 erythrocyte membrane protein 1, PfEMP1
  • PF10_0012 erythrocyte membrane protein 1 (PfEMP1), truncated
  • PF10_0406 erythrocyte membrane protein 1, PfEMP1
  • PF11_0007 erythrocyte membrane protein 1, PfEMP1
  • PF11_0008 erythrocyte membrane protein 1, PfEMP1
  • PF11_0521 erythrocyte membrane protein 1, PfEMP1
  • PF11_0522 erythrocyte membrane protein 1 (PfEMP1), truncated
  • PF11_0523 erythrocyte membrane protein 1 (PfEMP1), truncated, pseudogene
  • PF13_0003 erythrocyte membrane protein 1, PfEMP1
  • PF14_0001 erythrocyte membrane protein 1 (PfEMP1), truncated, pseudogene
  • PF14_0773 erythrocyte membrane protein 1 (PfEMP1), truncated, pseudogene
  • PFA0005w erythrocyte membrane protein 1, PfEMP1
  • PFA0015c var-like erythrocyte membrane protein 1
  • PFA0085c erythrocyte membrane protein 1 (PfEMP1), exon2, pseudogene
  • PFA0695c erythrocyte membrane protein 1 (PfEMP1), exon2, pseudogene
  • PFA0755w erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFA0765c erythrocyte membrane protein 1, PfEMP1
  • PFB0010w erythrocyte membrane protein 1, PfEMP1
  • PFB0020c erythrocyte membrane protein 1 (PfEMP1), exon2
  • PFB0045c erythrocyte membrane protein 1 (PfEMP1), truncated
  • PFB0972w hypothetical protein
  • PFB0974c erythrocyte membrane protein 1 (PfEMP1), truncated, degenerate
  • PFB1025w erythrocyte membrane protein 1 (PfEMP1), truncated, degenerate
  • PFB1030w conserved Plasmodium falciparum protein family
  • PFB1045w erythrocyte membrane protein 1 (PfEMP1), truncated
  • PFB1055c erythrocyte membrane protein 1, PfEMP1
  • PFC0005w erythrocyte membrane protein 1, PfEMP1
  • PFC0015c erythrocyte membrane protein 1 (PfEMP1), exon2, pseudogene
  • PFC0115c erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFD0005w erythrocyte membrane protein 1, PfEMP1
  • PFD0020c erythrocyte membrane protein 1, PfEMP1
  • PFD0140w erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFD0615c erythrocyte membrane protein 1, PfEMP1
  • PFD0625c erythrocyte membrane protein 1, PfEMP1
  • PFD0630c erythrocyte membrane protein 1, PfEMP1
  • PFD0635c erythrocyte membrane protein 1, PfEMP1
  • PFD0995c erythrocyte membrane protein 1, PfEMP1
  • PFD1000c erythrocyte membrane protein 1, PfEMP1
  • PFD1005c erythrocyte membrane protein 1, PfEMP1
  • PFD1015c erythrocyte membrane protein 1, PfEMP1
  • PFD1235w erythrocyte membrane protein 1, PfEMP1
  • PFD1245c erythrocyte membrane protein 1, PfEMP1
  • PFE0005w erythrocyte membrane protein 1, PfEMP1
  • PFE1620c erythrocyte membrane protein 1, PfEMP1
  • PFE1625c erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFE1640w erythrocyte membrane protein 1 (PfEMP1), truncated
  • PFF0005c erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFF0010w erythrocyte membrane protein 1, PfEMP1
  • PFF0020c erythrocyte membrane protein 1 (PfEMP1)-like protein
  • PFF0030c erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFF0845c erythrocyte membrane protein 1, PfEMP1
  • PFF1580c erythrocyte membrane protein 1, PfEMP1
  • PFF1595c erythrocyte membrane protein 1, PfEMP1
  • PFI0005w erythrocyte membrane protein 1, PfEMP1
  • PFI0040c erythrocyte membrane protein 1 (PfEMP1), exon2, pseudogene
  • PFI1820w erythrocyte membrane protein 1, PfEMP1
  • PFI1830c erythrocyte membrane protein 1, PfEMP1
  • PFL0005w erythrocyte membrane protein 1, PfEMP1
  • PFL0020w erythrocyte membrane protein 1, PfEMP1
  • PFL0030c erythrocyte membrane protein 1, PfEMP1
  • PFL0935c erythrocyte membrane protein 1, PfEMP1
  • PFL0940c erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFL0945w erythrocyte membrane protein 1 (PfEMP1), exon2, pseudogene
  • PFL1947c erythrocyte membrane protein 1 (PfEMP1), pseudogene
  • PFL1950w erythrocyte membrane protein 1, PfEMP1
  • PFL1955w erythrocyte membrane protein 1, PfEMP1
  • PFL1970w erythrocyte membrane protein 1, PfEMP1
  • PFL2665c erythrocyte membrane protein 1, PfEMP1
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL1960w erythrocyte membrane protein 1, PfEMP1
MGPPSTAPDYSSAKDAKELLDKIGQQVHDKVKSESNGFKDELEGSLSLAKVSGVELADTLDPCKLIKEKHENLIGARGDP
CGKDGTGKEDDSKRFSKESGAECDEKKIKDNKSKGGNNEGACAPYRRLSLCNKNMEKMGRTSTTKHDLLLDVCMAANYEA
ESLIPYHDQYEATYKDYGSTMCTMLARSFADIGDIIRGRDLYSGNKVKKKKLDDSLKTIFGKIYEGLTGGVKERYTNDGG
DFFQLREDWWTANRETVWKAMTCSEHLKNSAYFRVTCSDKQGESIANHKCRCPMTSDGKPNDQVPTYFDYVPQYLRWFEE
WAEDFCRKKKIYVGIVKKYCLDETEEKYCSLNGCDCTQTVRAKGKLRYGNRCTDCLFACHRYEKWIDNQRKQFLKQRNKY
ADEIKKYINEASSSSGSGRQRRGARNENYDGYESKFYDILKNKRYENVDAFLGLLNNEKACQAVTDDKGGRINFKNVNSG
KNSGGGESGDRGKGASSTSDTSGTNDETKGTFYRSKYCQPCPICGMKKKGGKWEAKNDDKCKRGKLYEPTSSAKPTEIKI
LKSGENHDDIEKKLEAFCETQNRSDGSSSVHVGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGG
GGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGGGGGSGSKSDSQKLYEEWKCYKHDEVQKVQGQG
EEEDEDEVEEEDDLKSAGGLCILPNPKKKEESEAKSQNEPEQFQKTFYDFFTYWVAHMLKDSIHWRTEKLDKCINNTNGK
QTKCRKGCKGDCDCFLKWVNEKKTEWGKIKDHFKTQEGLDNEGENGIPESTRFGFTHDVVLGEFLELQFLNENNEENSKN
SLDSEEIKHLKNLRDIIKKKNQQAGAGATGKRTIMDELIDYEEGIAKDCQQKCQETQKPQQVDRDLARSATGPRDPSSPA
APTAGPVESAAVDDEDDDNEEEEEEEEEEDEKEEVGGSDVVEEKEEKEEEKEPEEQVEPQPAATTTQNDVKVCDTVDKLF
KDTTALQDACNLKYVKGKNYGWRCVAPSHTTSETTGKSESATSSSGATTAPAPSLTSPQATASANSANSVSSAVCIPPRR
RRLYVGKLEQWASGGNTQGGGGNTQVTPQAGGSEAQTQPQGKDAASTSPQVALLRDAFIQSAAIETFFLWHKYKMEKKKE
KEETQGQVYKQTDDEDKTPQELLNSGKIPDGFLRQMFYTLADYKDILFSGDKDKKNGYSDIINGDKEMKAKEEKIKEAIQ
KFFEQTRGAIPPPPSGTTPSSWWEQHAESIWNGMICALTYTDNSDTVAKGKASITQDTDLKDALWDENGATNEPIKYKYT
EATASGDNTPLTQFVLRPPYFRYLEEWGETFCRQRTRMLAKIRGECVKSGSERCSGDGEDCNDQLDADPTIVRDFLCSTC
GRHCSFYKKWIQRKKEEFTEQYNAYGGQKTKCQTESETAKEFCGTLNTFNDAAKFLERLKSGPCKNNENVEDNGKDKLDF
SKPNETFVPATNCKPCSSFKIDCKKAKCSNRDDTNVGFNCKKNGNGYITSDHIKNEDNFTDTIDMLVSDDNKNKSETVLE
ACEGADIFEGIKENKWKCGNVCGYVVCKPENGNGKIVNGKPNGENQIIIIRALFKRWLEYFLEDYNKIRKKLKPCMNNSD
GSPCIDNYKKKYQCVLQWISRKEEEWKKIKEHYEKQKPKNGDNNMKSLVTDILSGLYPQTDVNKAIKPCKGLTKFESFCG
LNRTESSKIKDGTPKDVVECLFQKIQKKIEECKQKHPQPSANNCTTSPTSDTPPDDEEDLLHEEEENQVKAPEICPTPQQ
EPEAEDEGECKAASPATSEEQTNQTSNPHETPVLKPEEEATAPTSPPRPPLVTSTLAWSVGIGFAAFTYFYLKKKTKSSV
GNLFQILQIPKGDYDIPTLKSTNRYIPYASDRHKGKTYIYMEGDTSGDEDKYAFMSDTTDVTSSESEYEELDINDIYVPG
SPKYKTLIEVVLEPSKRDTQNDMPSDDIPSDIPNSDTPPPITDDEWNQLKKDFISNMLQNTQNTEPNILRDNVDNNTHPT
PSRHTLDQKPFIMSIHDRNLLNGEEYNYDMSTNSGENNVYSGIDPTSDNRDPYSDKKDPISGTKDPISDNHHPYSGIDLI
NAALNGDYDLYDEILKRKENELFGTNHVKQTSTHSVAKNTNSDPVMNQLDLFHKWLDRHRDMCEKWDTNNKKEELLDKLK
EEWNKDNNKHNGENTINKTLNTDVSIHIHMDDPKPTNEFSNMDTYPNNSSMDNILDDLEKYNEPYYDVQDDIYYDVNDHD
ASTVDSNNMDVPSKVKLEMSVKNTQMMEEKYPIGDVWDI

Gene-Specific Links for PFL1960w

General Sub-Cellular Localisation Links