ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1720w (SHMTc)

serine hydroxymethyltransferase, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during early trophozoite and mid-to-late trophozoite and ring and schizont
apicoplast and mitochondrion during mid-to-late trophozoite and schizont
residual body during very late post-mitotic schizont

Who localised this protein by microscopy?

Read, M., Muller, I. B., Mitchell, S. L., Sims, P. F., Hyde, J. E.
Dynamic subcellular localization of isoforms of the folate pathway enzyme serine hydroxymethyltransferase (SHMT) through the erythrocytic cycle of Plasmodium falciparum. (2010, Malar J) PubMed / full text
   more detail about this publication

cytoplasm during early trophozoite and mid-to-late trophozoite and ring and schizont, apicoplast and mitochondrion during mid-to-late trophozoite and schizont, residual body during very late post-mitotic schizont
  • "As well as the expected cytoplasmic occupancy of PfSHMTc during all stages, localization into the mitochondrion and apicoplast occurred in a stage-specific manner. Although early trophozoites lacked visible organellar PfSHMTc, a significant percentage of parasites showed such fluorescence during the mid-to-late trophozoite and schizont stages. οΎ… In very late post-mitotic schizonts, both PfSHMTc and PfSHMTm were concentrated in the central region of the parasite that becomes the residual body on erythrocyte lysis and merozoite release. "
  • Microscopy type: Fixed Light
  • Microscopy method: polyclonal antibody to residues 369-438
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: cytoplasmic during ring and early trophozoite, cytoplasmic and mitochondrion and apicoplast during mid-to-late trophozoite and schizont, residual body during very late post-mitotic schizonts
  • Other genes localised in this publication: serine hydroxymethyltransferase, putative, acyl carrier protein, chorismate synthase, protein kinase 5

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10170

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL1720w serine hydroxymethyltransferase
MFNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKR
ALEAFNVSEEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESKLYKCNSEGY
VDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILR
GPRSALIFFNKKRNPGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPFFKEYTKQVLLNSKALAECLLKRNLDLVT
NGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDVDCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILL
TDELQQKYGKKLVDFKKGLVNNPKIDELKKEVVQWAKNLPFA

Gene-Specific Links for PFL1720w

General Sub-Cellular Localisation Links