ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1700c (VP1)

V-type K -independent H -translocating inorganic pyrophosphatase, a gene from Plasmodium falciparum

Compiled localisation
not exported and not intracellular and parasite plasma membrane during ring and trophozoite

Who localised this protein by microscopy?

McIntosh, M. T., Drozdowicz, Y. M., Laroiya, K., Rea, P. A., Vaidya, A. B.
Two classes of plant-like vacuolar-type H(+)-pyrophosphatases in malaria parasites. (2001 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane and not exported and not intracellular during ring and trophozoite
  • "Of the PfVP-GFP fusions, only parasites transfected with the PfVP1-GFP fusion yielded green fluorescence, which appeared to be localized to the parasite surface (Fig. 5C). Reminiscent of the immunofluorescence data ( Fig. 5A), an additional spot of intense fluorescence was often observed ( Fig. 5C). An intracellular or extracellular punctate fluorescence pattern was not observed."
  • Microscopy type: Live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: blast from AF283528, annotation matches
  • Localisation record: parasite surface and not intracellular and not extracellular during ring and trophozoite
  • Other genes localised in this publication: V-type H( )-translocating pyrophosphatase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12221

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132050 V-type H( )-translocating pyrophosphatase, putative
  • PBANKA_144980 inorganic pyrophosphatase, putative
  • PY00513 vacuolar-type H+ pumping pyrophosphatase-related
  • PY06858 V-type H(+)-translocating pyrophosphatase
  • PVX_100710 vacuolar-type H+ pumping pyrophosphatase, putative
  • PVX_117625 V-type H(+)-translocating pyrophosphatase, putative
  • PCHAS_132380 V-type H( )-translocating pyrophosphatase, putative
  • PCHAS_145210 inorganic pyrophosphatase, putative
  • PKH_124930 V-type H( )-translocating pyrophosphatase, putative
  • PKH_145370 vacuolar-type H -translocating inorganic pyrophosphatase, putative
  • NCLIV_064810 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL1700c V-type K -independent H -translocating inorganic pyrophosphatase
MVMLPLHENSSTIRKKYKKNNKFFGGETSVKNFLERYSFTNKKDNKKNEKGTKLNILKYMKLYMQKPVKHRITFNIIVFT
LFLVIIYIFYHKIENIKTVFLISLTLYSLYFLLFSLYMLSTILNDEYGDYNTLKKYDMTNNIYMNDNELNLINDKNDVQQ
INNSQNNNDNYVHQMTNDHNIQKKEIKKEYEKLKYDNHNNNENNLINPYNLEQNNQTFNQHISNEYEKNNINLIHTKNTN
NDNKGDMKNEIGTNEGYEISSFDSIGIPIKEGSEGFFTVQYNSIFKISIVFTLLILSLYIIRGEDTKLPQGDNQMTDMMN
NNNNNNNNNNNNSSSSNGTIIISSYAYGIITAISFLLGALCSSIAGYNGIYVAVRANVKVAKAATYSYKKALITCFRSGA
VSAIVNVALAIFGICSLLLLVNILYPTLAFSKYPLLIVGYGFGASLVAMLYQLAGGIYTKAADIGADLVGKVEKHIPEDD
PRNPAVIADLVGDNVGDCAGQCADLFESICAEIIASMILGGNLSENGIISEQTASYFVLFPLFVHSMDLLISTIGIYLVS
VKNNNEPFSTLNLECNTKIIDKKDINYFNNINSNMHVEESAMQPLNNNNKEESDLLYAKYDCDVTSEQLENPLKAMLKAY
FFTCSLGVVGFSFLCKLLFSLDNAKNAWIYFSFCGFIGMACSYLFVILTRYYTDYSYPKVKKIAHASLSGSATNIIAGLY
VGLESTFFPVIVISISLLLSYYLGLKSNITGDHNIINGLYGTSVATMGMLSTAVFILSMSNFGPIADNAGGIVEMCKQPK
YVRVITDKLDAVGNVTKANTKGFSVGSAALACFLLFSAFLSEVSVHSKMPFSTVDIAIPEVFIGGILGSVVVFLFAGWSL
DAVGKTAEEVLKEVRRQFNEHPGILTYKEKPDYHTCVAIISKRALIETIKPGLLGVLSPIIVGLIFKQLGILQNNQLLGA
QAMASFIMFSTSTGILMALFLNNAGGAWDNAKKYIESGYYGGKNSQAHVSSVIGDTVGDPCKDTAGPSIHVLIKLISTIT
MVITPLIASTTTKSVYS

Gene-Specific Links for PFL1700c

General Sub-Cellular Localisation Links