ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1660c ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
cytoplasmic structure and not exported during intraerythrocytic

Who localised this protein by microscopy?

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasmic structure and not exported during intraerythrocytic

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48294

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL1660c conserved Plasmodium protein, unknown function
MLFLLHIYIPQNSVAYVSNVFPMTYIYPSFTFVSFLLFSYLFSHFTYILKYEKKIIKRILSSNSLHVVHNFSFVKNDIER
NIIKDDKNDENIDNINKQYMSDEEKIEKKEKIEKNEKIEKNENGDHPQLFQHNYNNLNIRHNNNQMLDFLSSVQKKESRR
FYSINLKEKNFRWSMILSIGSKKKDLELGILTNSNITGLYCSYNYKDNDELKNLKYDITLSEDLKYVECKSIMCDNVEHS
SPCLPLENYFKLINDYKIRKRSCQNKFCDYVNNMNFLNMIDKLNDRNLSICSFNTTINNEQIKGFYFKDSFFLYKKIKTS
FLYFACITESDPLHFNNKLSGFIGLANYINDKEKYHNQNKKIYSTILYSFIYKSISKKNIFSLCFKQGGGFITFGGYDQN
VLTKKEAPLSKIQLYSIDKNTNKKYVQQLNSVDVYDLLWIHYYAKNKSYYSLFLKNVTATMDQNKMNSVINAEAKVDSYN
YFLSFPADITIKLKNFVHDKCPDTDQFNDCSNLIEKGLIKLKNKNIKDFPKIELLFEEGTVIVHPEDYIIHESDGVYRVL
INSSGELKLGIPFFLNKYLIFDNENERLGVSKSECALELNDNELFGVDLSSNDDPYEEKDDDSMKENLFQKYKTHIILIS
SGIFVSSIIGSILYFS

Gene-Specific Links for PFL1660c

General Sub-Cellular Localisation Links