ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1545c (Cpn60-2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

chaperonin, cpn60, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and not mitochondrion during schizont and trophozoite

Who localised this protein by microscopy?

Sato, S., Wilson, R. J.
The use of DsRED in single- and dual-color fluorescence labeling of mitochondrial and plastid organelles in Plasmodium falciparum. (2004 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during schizont and trophozoite
  • "This clearly showed that this Cpn60 ortholog is not a mitochondrial protein but a chaperone specifically localizing to the plastid."
  • Microscopy type: Light
  • Microscopy method: DsRED tag after 73 amino acids
  • Strain: 3D7
  • Gene model mapping comments: Blast from X75420, gene model inconsistent Annotation matches
  • Localisation record: Apicoplast and not mitochondria during troph and schizont
  • Other genes localised in this publication: heat shock protein 60, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18450

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_144680 chaperonin CPN60, mitochondrial precursor, putative
  • PY04757 chaperonin cpn60, mitochondrial precursor
  • PY04792 chaperonin cpn60, mitochondrial precursor
  • PVX_100550 chaperonin CPN60, mitochondrial precursor, putative
  • PCHAS_144900 chaperonin CPN60, mitochondrial precursor, putative
  • PKH_144920 chaperonin cpn60, mitochondrial
  • TGME49_040600 TCP-1/cpn60 chaperonin family protein, putative
  • NCLIV_016800 TCP-1/cpn60 chaperonin family protein, putative
  • TA03350 chaperonin CPN60, putative
  • BBOV_IV007010 chaperonin cpn60, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL1545c chaperonin, cpn60
MRMKRIHILLLVIFLLCLRYGYSIKKKRSPNNKNRLFINKRLKYINSKIISRRKENYVKMKMTENKVKGKDIIYGNECRN
ELLKGILTVSDVVKLTLGPRGRNVLLEKEYGSPLIINDGVTIAKNISLKDRKKNNGVKLMQESTNISNDKAGDGTSSTAL
MTATITKKGIEQVNRNHNPIPIQRGIQLASKMIIEKIKSLSTPIKTYKDILNIATIASNNDVHMGQIIANAYDKLGKNAA
IILDDNADINDKLEFTEGYNFDRGIINPYLLYNENKDYIEYSNVSTLITDQNIDNIQSILPILEIFAKNKQPLCIIADDF
SNEVLQTLIINKLKGAIKVVPIRAPSFGDRRKDYLKDLCIVTNSKYISADVGLDLNNLHNNMSSFDNNYLSLLGSANTLI
VKKDRTSLITKEEYKKEIDERINVLKKEYEETTSKYDKEKLNERIAALSGGIAKILIGGNSETEQKERKFKYEDATNAVK
SAIDIGYVPGGGVTYLEIIKSNFIQEIHKKIEEDLQISSNNDEKKYLELIGNLESEMELQKMGANIVVSSLDVITKQIAD
NAGVNGDNVVKIILNSKDKYGFGYDVNTNKFVNMVEKGIIDSTNVIISVIKNSCSIASMVLTTECMMVDHEKKDKGILDS
SINSPNYLSKHRRTYKHKLHDDEDTDEDDEEDEDDEDDEDDEDDDDYDDEDEEDEEDEEDEDDEDDEDSMNDGYNYDE

Gene-Specific Links for PFL1545c

General Sub-Cellular Localisation Links