ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1120c (GyrA)

DNA gyrase subunit A, a gene from Plasmodium falciparum

Compiled localisation
apicoplast during intraerythrocytic

Who localised this protein by microscopy?

Dar, M. A., Sharma, A., Mondal, N., Dhar, S. K.
Molecular cloning of apicoplast-targeted Plasmodium falciparum DNA gyrase genes: unique intrinsic ATPase activity and ATP-independent dimerization of PfGyrB subunit. (2007 Mar, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intraerythrocytic
  • "In the third and fourth panels, PfGyrA (green) and PfGyrB (red) show colocalization to the apicoplast."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, The deduced sequences perfectly matched the sequences reported in the database (see Fig. S1A and B in the supplemental material).
  • Localisation record: apicoplast during asexual
  • Other genes localised in this publication: DNA gyrase subunit B, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12828

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL1120c DNA gyrase subunit A
MSFKFSIVFVLYLLFLLKFNKRFIFLKSEKITSYINTQIPNYSSSPPFFLKKEAKNNIKKCYFIKREGYRNIGTKNASNA
FVLNFKSNRSTYTDNAFSCTSLCSEKKERKKVQDPYDLKAKKKEKTYELNDIKNNEKKKDDIVNASNDITNDKLDNINNN
INESRKLIKGEYYDVEICEILSKSFLSYANFLILNRCLCDYRDGLKTVQRRIIWSMYEINKGIDKKGYKKCARIVGEVIG
KYHPHGDKSVYDALVRLAQKHHNNNLLIKGYGNFGSVEYNAAAMRYTEAKISSFCYDILLDEINDENVEYIKNFDGNERE
PKVLCSKIPLLLINGCSGIAVSILSSIPCHNLIDVANCCINFLINENIRDDELFHIIKGPDFSTGGIIISKYDILKNIYN
SGKGNFEIRSNVFFEYIKNDKKVITKHINDLSSIENSDIDKLTKKIIIKNLPPNVKPNELIENIINLLNDKKNEHDNILL
RIRDESEKEDMRIVLELKKHSQIEQIHNFLSYLFKYTNMQISYHCNFVCIGYENTYTQFSLKSFIKLWCNNRIKFIKTNY
EIKNKNLQKQLNIIDLYLIIQNKILDIITFFQKNQNIEQIQLYLKNNFKLNPEQIKYILSIKLQKLINIKNIDFISQRNK
IMHQIKLNDEIINNVQNIKNLIIQELIYIKNKYGIHNLNKQCIIPSTPKYKYSYINSEYHPNFSKNKQIIDTYNTVSTND
NNINHSNYTHDLPNTDNVTKDKNVVETNVHKNIHISSDISNNIKNSDKNSSLTKNQDSDNMMPYRNTYIDSLDNNMKDIY
NNDEVLILITYGGYIKKIKINEKLKNHSNNIIKLSNVKYILKENEEKLNENNKRLKFNDLQKGNEQEKYKDNEQKLNNDI
GHNINIQNNNNDNNNNNNDNNNVLLLNEEEYNSYKIKKSILVRNRDKILLTDNYNKAFLLNVYDLHLSSYDSKGTPINQI
IHSSKNITGITKFQENKKYLIVCSENGKMKVINNDVFLKRKKKGIKLFKNKKNIYFSYCNFNDNCIVGTKNGYIIQFPLS
SFKISKKNSLGNKCISLAKNDKVVDLLSYENNEKNLKNYKIIFVTKNGFGKMINLNELKIQKKKGKGHRIMKFKKSKTRK
DNKKDIEKKQINAINNKDKDKDIPSNNDDNNILHNTKVDEFLGFKLYDMNKQNEKDILIMITDHAVLIRKNMSLLKEKNK
KHSSQIYAKMNKINQLVYFDII

Gene-Specific Links for PFL1120c

General Sub-Cellular Localisation Links