ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1090w (GAP45)

glideosome-associated protein 45, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during extracellular merozoite and late schizont and merozoite and ring and schizont and trophozoite
moving junction during invasion
not parasitophorous vacuole during extracellular merozoite and schizont
vesicle during early schizont and late schizont
during late schizont and not ring and not trophozoite

Who localised this protein by microscopy?

Yeoman, J. A., Hanssen, E., Maier, A. G., Klonis, N., Maco, B., Baum, J., Turnbull, L., Whitchurch, C. B., Dixon, M. W., Tilley, L.
Tracking Glideosome-associated protein 50 reveals the development and organization of the inner membrane complex of Plasmodium falciparum. (2011 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

inner membrane complex during late schizont

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

inner membrane complex

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

vesicle during early schizont and late schizont, inner membrane complex during merozoite

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during ring and schizont and trophozoite

Vaid, A., Thomas, D. C., Sharma, P.
Role of Ca2+/calmodulin-PfPKB signaling pathway in erythrocyte invasion by Plasmodium falciparum. (2008 Feb 29, J Biol Chem) PubMed / full text
   more detail about this publication

during late schizont and not ring and not trophozoite
  • ""
  • Microscopy type: Light
  • Microscopy method:
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during late schizont and not ring and not troph
  • Other genes localised in this publication: -

Baum, J., Richard, D., Healer, J., Rug, M., Krnajski, Z., Gilberger, T. W., Green, J. L., Holder, A. A., Cowman, A. F.
A conserved molecular motor drives cell invasion and gliding motility across malaria life cycle stages and other apicomplexan parasites. (2006 Feb 24, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular merozoite and late schizont and schizont, moving junction during invasion, not parasitophorous vacuole during extracellular merozoite and schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27863

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL1090w glideosome-associated protein 45
MGNKCSRSKVKEPKRKDIDELAERENLKKQSEEIIEEKPEEVVEQVEETHEEPLEQEQELDEQKIEEEEEEPEQVPKEEI
DYATQENKSFEEKHLEDLERSNSDIYSESQKFDNASDKLETGTQLTLSTEATGAVQQITKLSEPAHEESIYFTYRSVTPC
DMNKLDETAKVFSRRCGCDLGERHDENACKICRKIDLSDTPLLS

Gene-Specific Links for PFL1090w

General Sub-Cellular Localisation Links