ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL1085w ()

transcription factor with AP2 domain(s), putative, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL1085w transcription factor with AP2 domain(s), putative
MTAKILNPFDIPVYPSSKACKYEFNFPTRKESTFDYIPGKSIETNCSKENMVQPKHLNLLKMLKKYMYEIIEESCFDIKS
FNNISNGKRACNEVFYNLEDTIINDSRMNIKNKILQSNENVSNSCMDKKAICKKLDMLLNHRIEGNYCQDDVSNNASLQL
MQKGKEDKGNERIYCCTTKDVILHAHKPTMNYMNSYKLSSDYISKLHLFIVKKEKVLFFPILYAEMIIRYNMKFFPLSKL
YNIKNTASLMKCKRVFSYVIILHFLMNSICVTYSDDIHSSLYKNNDVMYFYVIKGKEVGLYEITKFPMNHISYDMNIFND
SKTYIGNMNYILEKNIEEHLFDNMYFILSSISYKNVFHMNIMHIHMKCYSNQTCMDLNKCFNFVKDIYISRKQNMCIIIG
TIKIDHMFCTCSCGSTANSNMENKNSNNNNNNNNNTGSKQSVNNSRASNNRKRINNTSSNNGNDDDEDEKYQNKRKKYFD
DCNMKDEHKKEGKNKQKNKKNNKNKKNNKNNNINNINNINNNNNNNNNNSNNNNNNNNNNNNNNNNNNNSFYNDCVLTNN
SFKGYMEENNFILNSHSSNSLDMGTHICYNYQNKINHNITKQCNDNNNTVFHNNYSHKDNVKVLNNIYNNIITDKERESN
DNDSTKQSMLNDDDADKLDNIKLNNYIYSNMNDYFTICDPNINIDKTTLHENYLRFQPNVLEKDVNGGNKHMTMRYIDNF
KHNSISNHNNNNNNSNNNNNSNNSNNNNNSNNSNNSNRLYNISSEALNSLKKNDSLYMRLQNIISFSSGHNNTKIKVINI
NNFNNNANKFKNLNMDNMNAPNGVTNLNVGINNEVVKEEKTNTCLNINEQIHSHTKLKCIKNGKPRNINQKENNVVYIES
DNSHNDNNNNNNNNNNNNNNNNNNNNNNNNNNSFENNMLLLCKSKNVKNQNRMNNLFRKEENKDTKLKSLNYNILINPCY
NKNNVINELFMNTKEKSLYGNTNKFHNTLNNNMNMNNYNNQNINNIYPLTHNISIVNHILNHSYYNENTEQNNKNLFHNT
ILVPKNCNNIMNNSDKYNYLNAYNQNYTLYNNTLNNNNSLVQPSDVNNMNCSYESINGNMPINDQSCDTYNDEYNDTYND
TYNDTYNDTYNDTHNDTHNDTHNDTYNDEYNDTYNEINNETYNDTLNDTPNDTLYDTLNGITNDTPYITPTNACNLSYEE
LMYKMQNNNNIYCKKHDSNYIISNGINNHICAHKEVNYNVLNHVTNINTYVNSKNIFSNVAVTNDTDLHACNNEQRNNIS
NHNINKNVVNLNNVHSINKELNNYPINSTQDYNTNYDKNGCLGTLTCDIKNKNNKNNKNNKNNKNNKNNKNNKNKNNNDN
NNNNNNNNNNSNNNKDIIILNKNNINNANIFNINSLKEKLLNDDISKNKEKKKKKCVIRKIKKRNKVNPKRNNNINNRNK
NNGSYKCDTKRVNKINNGFMKNFKNKYTSSCINYNMCAISDLSTNIKNKENFVIGNYPYTNGVSYITNGENNTTNNGKKN
DDHRNKKKEYNSNENNNYCNNNSNRNNNNNNNNSHFGGNKNNRGDDNDEDDQEKNNKRNIYGKNGDDEEEDYDGEDDNNE
ENDHNNKKNIKRKNKKSNKAYNNNDDENKCINNKDTFHLPKKHNYEYTMNNNYNMNNEYNKDDEEIKNNYEDNQDNGDIK
HKSCTNGNDVDGVKSKYHKNDHSGDNNNDINNNSDSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSCTNNCATVDD
LMNLNSSNLGKFSYLTNVLSHNINNINFINNNNHKMNFLNNENVNQFFNNMNYKDYVNNMNYLEPNNYINHNINELNYFN
KNMILNNLNYINYVNGINNDRYMNGINNSQMSYNNHFRNDIISNVLKGVRVINKESHYKNKNNKNGNSNNNNNNNNNNNN
EDEDDDNNQNNNNDNDGDDNNDNDNNEENNNIDDRIPFKHHNMNNVSMKNNDGKNEDNNNNKNNNNNNNNNNNNNNNNSN
DNNNNRNGNNNIINPFFLYNKMFCMNNNANNFNNGNIINNFTNNGMAHNHNPNMNINSFRNNNMHLFHKYGIQYKDLIPM
NMFPTAYLNLGRERRSSKYENSSYNKKKDLMKRRYELQKAILLNVDENLKEVIDEIIRNSTILPQKGIRGRNTLDCNHPI
HSVWKDTTRGHCSWRCRWWENGRRLSKNFNVKRFGNDGALRMAITMKLKKSNPKEQMQLLKQQREYLKLCYGDNWEKKIK
ELQNVNNANQTVNNNNNNINKNNIDNNNQNDNNSSKSNNSNNSNNNSNNQHYVSANADINNDATITFNNPLNNKNVPYQY
LNLKDKKQTFQQYNHIKDRENSYPYMHIKGETQQNGMKLKNDINNHHSQNQLSLSKQENNIYKNNVMDEKLLIQNLKACI
NESNNNNNNNNYNVQKRIQNNYYHKGGNNRNI

Gene-Specific Links for PFL1085w

General Sub-Cellular Localisation Links