ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0925w (Formin2)

formin 2, putative, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during trophozoite

Who localised this protein by microscopy?

Baum, J., Tonkin, C. J., Paul, A. S., Rug, M., Smith, B. J., Gould, S. B., Richard, D., Pollard, T. D., Cowman, A. F.
A malaria parasite formin regulates actin polymerization and localizes to the parasite-erythrocyte moving junction during invasion. (2008 Mar 13, Cell Host Microbe) PubMed / full text
   more detail about this publication

cytoplasm during trophozoite
  • "PfFormin2 expression peaks 24 hr postinvasion at the mid trophozoite stage (Figure1B), a time of parasite growth and nuclear division and, by immunofluorescence, localizes diffusely through the trophozoite cell cytoplasm though largely absent from the nucleus (Figure1C) "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Cytoplasm during trophozoite
  • Other genes localised in this publication: formin 1, putative, rhoptry neck protein 4, formin homology 2 domain-containing protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29574

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL0925w formin 2, putative
MKDFMDRNEKHVYEKYIENKNKDDNRIDNNKGNFHTNVNKNIHMYTMKNWLNKKEKENRKKSLLNMNKTYKEDDERNIYY
NNNKTDENTYNNVVDDNYINNNKNKIIFQHFRNTERKTYYNGMVKGRELLYKNIKMNENKNNQISNINLTNYLLVPDEIR
HKYTKTYLFQISKRLLVMKKPWRLPKNVELQINNVYHLSNYIKVLERIASEYLNDPPINYYYRGLELYNKNVFANIDYLL
KKVDIKEDTQTFHLKNLIKINECYYDLSTFGKSPNTIFYQSYIILDIHSNTLTLEDEYENLFESQILNYGYGEKEYPNLK
YLLSVCSSILFWLNFNKKDNFAIINYHKISSFILLIFSCAMLAIDNSLTFDQIQEILYKSSKINNNDNEDNNTNSDTSSN
YFSNNIHNNSEQHKNKNIYEENNTTHGIDIHENNNNNNNYNINKYYIREDVKQHDDILLNNNLVRPKLLYNEKREGLDVE
PNLYLPTYNYFENTNSKKLLNKDEKCSESTLEYKNNYAPNYNENMRHTINVNRKNVLYENEFDDMKNKKSKDDKVSSTSC
GMDSLNKDTNKTNNKFKDHHFWIPFDYWKASHKRYFYYMYDLIKNKNKRVENNTFKIKSIIFTDYAPCSVSIEIYEIIYK
DNSELNSDLLSESETDVYDESEENDEIEENDESEENDESEDNDESEDNDESEDNDEIQQNDNSQHNDEIQQNDECDDKYI
NTHKMKGTDTIYASNQNLKHYSFQKNGTGIEYEEKGLWVYSDREKKLVPAPRIPKDEFKRCSNDENIDNNNNNSDYNSDD
DDDEKHLCECSLNKHHGRKKKNKKKNKKKQNIKKLSVEHFSQTVYPNENNKNNINNKNNINIINNKNNINIINNKIYRKN
FSCNVPSLETKQANILDINNTPKIDFDISHLNQRNNKKKKKKKKKIQSDQNSVVGTNYQKDISYNNKSLIGLSHNKINSS
INTLNVFNEDDSLTSINQHSEIHSRVESEFDKVEKSVTHLWSNSNFPLKNQIKKVSSVFSPRTINSNSSCKSISFVDKLT
SSKRDDFSSGRSIQTSESKESFSDNKKNIIYDHFDKKEKSSFFYNKSQIFHKDENNMKNDFSEYLQKMKSKKKETHQIDK
QQDIKQNVDEYYHLKNDKKKNNKYKLYGLLKNNYIKGKEKDTNDNEEQIKYHINHDNDNDNYLNENMKKKKKKIKSEEKC
KTNSSKCGYEYFLKCNPINYNVVSSYEKNKKKYITIDFTHDAEGNVKEHIICGDILILIGHKNIEKFHKGFSSSYSFHTG
FLKKGSSEVLHLKKEDMDININYDNYIPDNMKISIILDAATKQDCLRSYKKSLRSNNKMEELEALKNFERRKSFVLNDSA
ESVMNMLRDFPSEFSPSEKTYDYFDKINSLEKMMKCAKKSDVTNENCASTENNESLKEVLKNEKQQEQKKDYEKDKHKIY
DENDKHKIYDENDKNKIYDENDKHKIYDEKDKHKIYDENDKNKIYDEKDKHKICDENNKNNIYDEKDKHKIYDENDKNKI
YDEKDKNKIYDEKDKNKIYDENDKHKIYDENNKNNIYDENDKNKIYDENNKNNIYDKKNNVEKNNKIDNKTNVYESIVEK
HYCDHSDIEKNKGQKIDIQYSIEKNHFDSIQNDPLEEKEELMNTYKKGHSFNKVKELYEQESLDIYNKKNLDFNSRSHYN
AYSVFNEKEPTLKYNATNITQLLTSLFGFRNRDDKYSLNKKQSMCSLLTSKKSYSNIISLKDYLQRQYEIIIKPSENITS
FVKSHVIKINVPLLNFLKKITNLSNIKIQLSLKLCNNDLNKSLNFIVCTWGINILKKKSPAKYSSSWNQIPEYRREFKKI
LGYHNFSSKSSLDTSKCVNKLDSVSEMDSTNYTNISYYKMLKDVKSLYDEGSKKRIHTDECIYRIEDEEEEEKKKNKQEI
NNNYILSLLRKKEKNEIGKRIIDRKEKIKDEKETDYSPKDTSSEVSTSTDMMKFTQLCTNKKENKEKEDNHVHRKITKSD
IITNKKEKHDVNNIEEIQKNDTDILINNDVNKNKSDMLKRADNYIISNNNNNNISLKKTIGESSFFYAKLPSGELIKLKV
NDSVELSTHDSMPLLLVEPIDDITDEMKKEITEWNSLSKMNSQTSSKENTMSDNNNLHKDYLINDLEVMYNKLNKKGSIE
STFSMESERSVTSRLSPSIPGETLTSLVNVKDKKEIIVEDKREVIDEDKKIETVEEGTKESKIEGKNEIIDEEKKESKIE
GKNEIIDEEKKESKIEDKKEIIDEEKKESKIEDKKEIIDEQKIDEKQNNVTSEENKAANDKQIKAKAIEALLKQSKAKRP
PPPLPAALLKSVNVAKEKPEMKEEEIVKTENNTKLAFTKKGGKKIPAPPPFLLKKMGDKSKCVLKKCPEAFGLKKAAKVP
EKRPLGIKLHWQLLPTHKIEGTVFNEIKTQEVKYNLIDTKAVHKLFARVKGEKKIIKKSVDDKQEKPEEKLVTVLDRTRA
QNIGILLRFPMSTQEIVDKINSFDLTDLNVDFLQKVLHIIPSKEECDGILQKLENEKIKTEQFRDVERKLIPFVYLDKCQ
SKIQICLFSLKYDKMINEINKDLDIYDKAVKEVRSSIRLRSLLKAVLKWGNYVNYGINDNEDLVALGFTLSSVLKLSEFK
SSIDSKITSLHYITVTLCMYLPNLNMNLLENDLLSVLTASKMSSESIDIIFSSLEKEITYIKGQLKTNYEEKFKEKMVSL
LEDSEQKYNTAQKQYEQTKKDVKELGIYLGEDMPKNGNLENIFIILSSIVDSFTKCYKDILANPKKFSIMLNEESLLDDY
YNVFCKGKKRPIIKMNSISTNSDTKEDDMIKNKSIPDIKIKINKSKSVSVKKNDHGKSTMFQLRNQLMQDIQNRSILKKS
LVFPNTSENESSSIQPSQQNGVDNSIAKKEAEQNIKKEEELKSDNGIKIKEVQTLNDESKNVNVNNTMNDVVTVENKSDE
KQNKDIKVEDIKNT

Gene-Specific Links for PFL0925w

General Sub-Cellular Localisation Links