ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0740c (Cpn10)

10 kd chaperonin, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion and not apicoplast during ring and schizont

Who localised this protein by microscopy?

Sato, S., Wilson, R. J.
Organelle-specific cochaperonins in apicomplexan parasites. (2005 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during ring and schizont
  • "Transfection experiments using fluorescent reporters showed specific localization of PfCpn10 to the mitochondrion and PfCpn20 to the plastid."
  • Microscopy type: Light
  • Microscopy method: DsRED tag after first 55 amino acids
  • Strain: 3D7
  • Gene model mapping comments: Blast from AJ575562, annotation matches
  • Localisation record: Mitochondria and not apicoplast during ring and schizont
  • Other genes localised in this publication: cochaperonin, acyl carrier protein, heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10311

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL0740c 10 kd chaperonin
MSSTITRKFIPLMDRILISKIVPKTTTKSGLFLPESATEPSYTGKVLAVGPGRVTSNGTKISPSVKEGDVVVLPEYGGSS
LKIDGEEFFVYRDDDIIGIIKDE

Gene-Specific Links for PFL0740c

General Sub-Cellular Localisation Links