ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0725w (pftrx-px2, TPx-2)

thioredoxin peroxidase 2, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during intraerythrocytic and schizont and trophozoite

Who localised this protein by microscopy?

Boucher, I. W., McMillan, P. J., Gabrielsen, M., Akerman, S. E., Brannigan, J. A., Schnick, C., Brzozowski, A. M., Wilkinson, A. J., Muller, S.
Structural and biochemical characterization of a mitochondrial peroxiredoxin from Plasmodium falciparum. (2006 Aug, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during intraerythrocytic
  • "We have analysed the biochemical and structural features of the mitochondrial peroxiredoxin and thioredoxin of P. falciparum. The mitochondrial localization of both proteins was confirmed by expressing green fluorescent protein fusions in parasite erythrocytic stages."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain:
  • Gene model mapping comments: Blast from AAK20024, annotation matches
  • Localisation record: Mitochondria during erythrocytic stage
  • Comment: strain information not found
  • Other genes localised in this publication: thioredoxin 2

Yano, K., Komaki-Yasuda, K., Kobayashi, T., Takemae, H., Kita, K., Kano, S., Kawazu, S.
Expression of mRNAs and proteins for peroxiredoxins in Plasmodium falciparum erythrocytic stage. (2005 Mar, Parasitol Int) PubMed / full text
   more detail about this publication

mitochondrion during schizont and trophozoite
  • "Double staining of parasite cells with anti-PfTPx-2 serum and Mito Tracker® revealed that PfTPx-2 was present in mitochondria (Fig. 4A–F)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR-3
  • Gene model mapping comments: blast from AF225978, annotation matches
  • Localisation record: mitochondria during trophozoite and schizont
  • Other genes localised in this publication: thioredoxin peroxidase 1, 1-cys peroxiredoxin, thioredoxin, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10063

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL0725w thioredoxin peroxidase 2
MFLKKLCRSNFFGNSRRSFSLVTKKAYNFTAQGLNKNNEIINVDLSSFIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKD
FENKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVEFTLVSDINKDISKNYNVLYDNSFALRGLFIIDKNGCVRHQTVND
LPIGRNVQEVLRTIDSIIHVDTSGEVCPINWKKGQKAFKPTTESLIDYMNNANKNV

Gene-Specific Links for PFL0725w

General Sub-Cellular Localisation Links