ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0690c (SET5)

histone-lysine N-methyltransferase, putative, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion and not nucleus

Who localised this protein by microscopy?

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not nucleus

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27577

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL0690c histone-lysine N-methyltransferase, putative
MILFKRNFHNYFANNFIKDLFKKSQHISFNDIQKKIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDY
LYEGKEPSKNKAIVDIIINRKKETSNYKLLPLGYGILYNHSDIPNAYVEIHKINKNQIKQKQDVTVSNNVMIVYAYNNIQ
KDDEILISYGHSWWKVSS

Gene-Specific Links for PFL0690c

General Sub-Cellular Localisation Links