ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0600w ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytosol and parasitophorous vacuole during 18-36 hours after merozoite invasion

Who localised this protein by microscopy?

van Ooij, C., Tamez, P., Bhattacharjee, S., Hiller, N. L., Harrison, T., Liolios, K., Kooij, T., Ramesar, J., Balu, B., Adams, J., Waters, A. P., Janse, C. J., Haldar, K.
The malaria secretome: from algorithms to essential function in blood stage infection. (2008 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

erythrocyte cytosol and parasitophorous vacuole during 18-36 hours after merozoite invasion

Orthology

OrthoMCL

Part of OrthoMCL group OG4_41277

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFL0600w conserved Plasmodium protein, unknown function
MIYYIRKVAINFLFLYIINFCLLHYLKECNTSNYSRILKEQNGKKYIYYNLSKKKNNGIIKGGSKHNGHLFINNYKKKRN
VKYKINKYKPCSIFSFFKKKDKNDKNDKNDKTHMKDNSNLENKEKGEIGKDKEQKEKEKEKIIILKDNKKLDEKKKKELQ
KEEKKTKLTNVLKQNNKNKNNNNKNNNNKNNNNNNNNNNNNNNMDDTLKKDKQTELIKKDNLNNKNDVKKKKIDLNINNI
DTNSRDILKNENKYKKHLENVKDKFIISLNQIFCSYMNSLDKKENFKYFFEKILQNVEKNFHTYTFIIDIEKMNNQQIKK
TYMINNINCFNEIMNIIQENLYNILVFKIQYLKVKAINDIKEIISNKKNMNDYISYSNNINKIIQIYEEQLTKLCPLNYI
FTLYNNFMENNNYLLNFSYQLPLYKYKNIIDSNIEYLRTFSNDLTKHKKKSLYNEIEKNKNYQSILQIIDNQQKQIEVLQ
EQLETSIDGINGKYSPFNCALAYRIPDTNLNISTQYVKGKFNVKVNCIPDDSLHLLGSYGFVKGLPYGNLGLSLSLNF

Gene-Specific Links for PFL0600w

General Sub-Cellular Localisation Links