ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0185c (NAPL)

nucleosome assembly protein, a gene from Plasmodium falciparum

Compiled localisation
area around nucleus and nuclear membrane and nucleus during early ring and extracellular merozoite and gametocyte stage ii and gametocyte stage v and late ring and schizont and trophozoite

Who localised this protein by microscopy?

Chandra, B. R., Olivieri, A., Silvestrini, F., Alano, P., Sharma, A.
Biochemical characterization of the two nucleosome assembly proteins from Plasmodium falciparum. (2005 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

area around nucleus and nuclear membrane and nucleus during early ring and extracellular merozoite and gametocyte stage ii and gametocyte stage v and late ring and schizont and trophozoite
  • "PfNAPL was predominantly localised in the cytoplasm in asexual and sexual stages of the parasite. PfNAPS did not co-localise with PfNAPL and was more intimately associated with the parasite nucleus, most strikingly in P. falciparum gametocytes."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7A
  • Gene model mapping comments: Taken directly from publication, length matches, gene model updated correctly as of PlasmoDB 6.0 (or possibly earlier)
  • Localisation record: nucleoplasm and nuclear membrane and nucleus surrounding regions during early ring and late ring and troph and schizont and free merozoite and stage V gametocytes and stage II gametocyte
  • Other genes localised in this publication: nucleosome assembly protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10768

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL0185c nucleosome assembly protein
MAANEGNQPIPPEEEKEISSLLESIKIDDDKMTDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYD
KRREALVGNGEAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKKNKEKKEGFILSFYFATNPFFSN
SVLTKTYHMKCVDCDNEPVLLHTEATVIDWYDNKNILKKNVVKKQHNKNSREVKTVQQTVNRDSFFHFFTSHKVPNSNVI
KQLSKHEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGIIIESESNSIVSDVDSSYSSSENNSNYNSYESNNSAYNDEN
SNVDTNEYDDNEEEEEGAKSNEDPLTS

Gene-Specific Links for PFL0185c

General Sub-Cellular Localisation Links