ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0145c (HMGB1)

high mobility group protein, a gene from Plasmodium falciparum

Compiled localisation
nucleus during gametocyte and schizont and trophozoite
not cytoplasm during gametocyte

Who localised this protein by microscopy?

Briquet, S., Boschet, C., Gissot, M., Tissandie, E., Sevilla, E., Franetich, J. F., Thiery, I., Hamid, Z., Bourgouin, C., Vaquero, C.
High-mobility-group box nuclear factors of Plasmodium falciparum. (2006 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

nucleus during gametocyte and schizont and trophozoite, not cytoplasm during gametocyte
  • "Finally, immunofluorescence studies revealed differential subcellular localizations: both factors were observed in the nucleus of asexual- and sexual-stage cells, and PfHMGB2 was also detected in the cytoplasm of gametocytes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, blast from primer
  • Localisation record: Nucleus during troph and schizont, nucleus and not cytoplasm during gametocyte
  • Comment: The level of PfHMGB1 expression was clearly lower in gametocytes than in mixed asexual stages, in contrast to PfHMGB2, whose expression was higher in gametocytes.
  • Other genes localised in this publication: high mobility group protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10272

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFL0145c high mobility group protein
MKNTGKEVRKRRKNKKDPHAPKRSLSAYMFFAKEKRAEIISKQPELSKDVATVGKMIGEAWNKLGEKEKAPFEKKAQEDK
LRYEKEKAEYANMKMKA

Gene-Specific Links for PFL0145c

General Sub-Cellular Localisation Links