ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFL0040c (FIKK12)

serine/threonine protein kinase, FIKK family, a gene from Plasmodium falciparum

Compiled localisation
during not ring
erythrocyte cytoplasm and erythrocyte plasma membrane during trophozoite
not maurer's cleft during trophozoite

Who localised this protein by microscopy?

Nunes, M. C., Goldring, J. P., Doerig, C., Scherf, A.
A novel protein kinase family in Plasmodium falciparum is differentially transcribed and secreted to various cellular compartments of the host cell. (2007 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

during not ring, erythrocyte cytoplasm and erythrocyte plasma membrane during trophozoite, not maurer's cleft during trophozoite

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PFL0040c serine/threonine protein kinase, FIKK family
MYILRNMFCIKFMLYFLWLLYLLFLNIEFIKFKTFQSLVSYDRPSKCLSENSKHHVNSDNNKGNKLFGQKQFGNINKCDV
KDDELKISKDNTSKKKKICFKKEKRSNEEEYNNLEKESVEGTCNLLNILNVEKTKVFDNYESTYKHGENNDIICMSNLKE
DESKENYIYNWNLGKESLVKFLGFSDYFKINGVKYSDFELTSIPIIGENKSKGRVQEMFKTVIPSNDGDPAKEVKLFIKR
IPVEWWIKQFNLMEKYDGEYLVKAENYVMEGVALSFLSEHHPGIAPKLLKILYDGKNVNHDIMEEYKFKDIYEFNNMLIE
RINNNMDGYIVMVSELFGEDLFDFNKRFTKEKSDVRNSDEFKKELLYKCLRLLVRLHSAGLSHLDLTAENVLITDDYDIR
LCDFAKSTPLYSDKLRHIDKKKKKKVYLFESCVPTIGKREYTPIECWRIRKKLREKNITDPFEHVKTISMQRFRKEYYFN
VSHADYFMLGVLFIWIWNCGHMWKTSFPSESVNFTTFLENNMNLSCYPSTKSWPSDFKFIVKELMNEECRKKLNLKNLMT
HPWFNET

Gene-Specific Links for PFL0040c

General Sub-Cellular Localisation Links