ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1780w ()

Plasmodium exported protein (PHISTc), unknown function, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytosol

Who localised this protein by microscopy?

Sargeant, T. J., Marti, M., Caler, E., Carlton, J. M., Simpson, K., Speed, T. P., Cowman, A. F.
Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites. (2006, Genome Biol) PubMed / full text
   more detail about this publication

erythrocyte cytosol

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PFI1780w Plasmodium exported protein (PHISTc), unknown function
MAVSTYNNTRRNGLRYVLKRRTILSVFAVICMLSLNLSIFENNNNNYGFHCNKRHFKSLAEASPEEHNNLRSHSTSDPKK
NEEKSLSDEINKCDMKKYTAEEINEMINSSNEFINRNDMNIIFSYVHESEREKFKKVEENIFKFIQSIVETYKIPDEYKM
RKFKFAHFEMQGYALKQEKFLLEYAFLSLNGKLCERKKFKEVLEYVKREWIEFRKSMFDVWKEKLASEFREHGEMLNQKR
KLKQHELDRRAQREKMLEEHSRGIFAKGYLGEVESETIKKKTEHHENVNEDNVEKPKLQQHKVQPPKVQQQKVQPPKSQQ
QKVQPPKSQQQKVQPPKVQQQKVQPPKVQKPKLQNQKGQKQVSPKAKGNNQAKPTKGNKLKKN

Gene-Specific Links for PFI1780w

General Sub-Cellular Localisation Links