ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1760w (REX4)

ring-exported protein 4, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and erythrocyte cytoplasm during ring

Who localised this protein by microscopy?

Spielmann, T., Hawthorne, P. L., Dixon, M. W., Hannemann, M., Klotz, K., Kemp, D. J., Klonis, N., Tilley, L., Trenholme, K. R., Gardiner, D. L.
A cluster of ring stage-specific genes linked to a locus implicated in cytoadherence in Plasmodium falciparum codes for PEXEL-negative and PEXEL-positive proteins exported into the host cell. (2006 Aug, Mol Biol Cell) PubMed / full text
   more detail about this publication

cytoplasm and erythrocyte cytoplasm during ring
  • "GFP-tagged REX4 is located in the host cell cytoplasm with some protein remaining inside the parasite, similar to the location of GFP-tagged REX3 (Figure 7B)."
  • Microscopy type: Light
  • Microscopy method: GFP
  • Strain: 3D7, not D10
  • Gene model mapping comments: Taken directly from paper, which agrees with the gene models
  • Localisation record: Erythrocyte Cytoplasm and cytoplasm during ring
  • Other genes localised in this publication: ring-exported protein 2, ring-exported protein 3, early transcribed membrane protein 4

Orthology

OrthoMCL

Part of OrthoMCL group OG4_118714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI1760w ring-exported protein 4
MGNFFIISYNKHCIGQIIHMLYFICLIFILYNRNTCLRRIAKCGRNLSELNLDLRTDYDEREININKNIPSYPVKFSKLE
YKLRNEWDELEIDEHDDYMDVTVECFEKLLENDKNLENYQENYEIRALVAYMLHELRRGYINEQKMKFKNFLHKLKEKRI
NEPIDTLNNDEQDEWNKIKNGKIKSDEEWKSYQLQTWEYLIKMEYYKNKYSQNV

Gene-Specific Links for PFI1760w

General Sub-Cellular Localisation Links