ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1755c (REX3, Rex3)

ring-exported protein 3, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm during intraerythrocytic and ring and schizont and trophozoite
cytoplasm during ring
erythrocyte cytosol

Who localised this protein by microscopy?

Osborne, A. R., Speicher, K. D., Tamez, P. A., Bhattacharjee, S., Speicher, D. W., Haldar, K.
The host targeting motif in exported Plasmodium proteins is cleaved in the parasite endoplasmic reticulum. (2010 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during ring and schizont and trophozoite
  • "Localization of PFI1755c:GFP. GFP fluorescence, in live cells, is seen in the erythrocyte cytoplasm indicating that the protein is efficiently exported."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: erythrocyte cytoplasm during blood stages
  • Other genes localised in this publication: -

Jackson, K. E., Spielmann, T., Hanssen, E., Adisa, A., Separovic, F., Dixon, M. W., Trenholme, K. R., Hawthorne, P. L., Gardiner, D. L., Gilberger, T., Tilley, L.
Selective permeabilization of the host cell membrane of Plasmodium falciparum-infected red blood cells with streptolysin O and equinatoxin II. (2007 Apr 1, Biochem J) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during intraerythrocytic
  • "a parasite protein that is present in the RBC cytoplasm; [20]"
  • Microscopy type: live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: RBC cytoplasm during intraerythrocytic
  • Other genes localised in this publication: circumsporozoite-related antigen, erythrocyte membrane protein 1, PfEMP1

Sargeant, T. J., Marti, M., Caler, E., Carlton, J. M., Simpson, K., Speed, T. P., Cowman, A. F.
Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites. (2006, Genome Biol) PubMed / full text
   more detail about this publication

erythrocyte cytosol

Spielmann, T., Hawthorne, P. L., Dixon, M. W., Hannemann, M., Klotz, K., Kemp, D. J., Klonis, N., Tilley, L., Trenholme, K. R., Gardiner, D. L.
A cluster of ring stage-specific genes linked to a locus implicated in cytoadherence in Plasmodium falciparum codes for PEXEL-negative and PEXEL-positive proteins exported into the host cell. (2006 Aug, Mol Biol Cell) PubMed / full text
   more detail about this publication

cytoplasm and erythrocyte cytoplasm during ring
  • "The serum raised against REX3 also reacted only with 3D7 but not D10 parasites (Figure 4A). Similar to REX2, it stained predominantly the area outside of the PVM as judged by colocation with ETRAMP4myc in transgenic parasites (Figure 4B). However, the staining was more uniform than seen with Maurers cleft proteins and colocation IFAs with REX1 in 3D7 parasites showed that REX3 staining was not restricted to the clefts (Figure 4C)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7, not D10
  • Gene model mapping comments: Taken directly from paper, which agrees with the gene models
  • Localisation record: Erythrocyte Cytoplasm and cytoplasm during ring
  • Other genes localised in this publication: ring-exported protein 2, ring-exported protein 4, early transcribed membrane protein 4

Orthology

OrthoMCL

Part of OrthoMCL group OG4_84707

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_093695 hypothetical protein, conserved
  • PKH_011750 conserved Plasmodium protein, unknown function
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI1755c ring-exported protein 3
MQTRKYNKMLSKVETKQFIYILFFLCLYLNTFNYKYTTSYEGSSFRQLSEPVVEEQDLKKTNAESSHIEATTSQATTSQA
TTSQATTSQATTSQATTSQATSSQESDEQGLTAPSLNLEETQSNKVRNKIFNFPIPSAEGTVSKEFKNQPKTEYEKKLFE
EWQHLNMFEHSNWVNITVQSCQVLVQGLTSLDDYDAKFKSWSAMVELLGEFRITLFNESNNMFEALLNELREARKENPNE
NLTPEEEEKWDLIKQTKLEKDIEWKIYQILTWKYWNLKEFPGVDIPDPSVPSLDFDATYDVLGDILEDDEDEEDDEDTAK
PSTSSS

Gene-Specific Links for PFI1755c

General Sub-Cellular Localisation Links