ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1740c-a (REX2)

ring-exported protein 2, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm and maurer's cleft

Who localised this protein by microscopy?

Spielmann, T., Hawthorne, P. L., Dixon, M. W., Hannemann, M., Klotz, K., Kemp, D. J., Klonis, N., Tilley, L., Trenholme, K. R., Gardiner, D. L.
A cluster of ring stage-specific genes linked to a locus implicated in cytoadherence in Plasmodium falciparum codes for PEXEL-negative and PEXEL-positive proteins exported into the host cell. (2006 Aug, Mol Biol Cell) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm and maurer's cleft
  • "IFAs with 3D7 parasites expressing a myc-tagged ETRAMP4 (Spielmann et al., 2006 ) showed that REX2 (green; Cy2) has a dotty appearance outside of the PVM (ETRAMP4myc in the PVM detected by a rabbit anti-myc antibody; red, Texas Red). No REX2 signal was detectable in D10 parasites expressing ETRAMP4myc (D). (C) REX2 (green; Cy2) colocalized with the Maurers cleft protein REX1 (Hawthorne et al., 2004 ) (red; Texas Red) in 3D7 parasites. Bars, 5 m."
  • Microscopy type: Light
  • Microscopy method: antibody, GFP tag
  • Strain: 3D7, not D10
  • Gene model mapping comments: Blast from AJ290921, blast from primers AATAAGAATAAGCTTAAAAAACAACAAAGGTTAAC and CTAATGTTGTTGTTGATCATACTG, annotation doesn't match, -b is annotated as REX2 but -a matches genbank and primers where -b doesn't
  • Localisation record: Maurer's Cleft and RBC Surface
  • Other genes localised in this publication: ring-exported protein 3, ring-exported protein 4, early transcribed membrane protein 4

Orthology

OrthoMCL

Part of OrthoMCL group OG4_118713

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI1740c-a ring-exported protein 2
MKMYLAEIFSSGKESLLSLKDTLGSSNFSPLKPCEGLECLPQVLFLYVIFLLLCTGIFMHNKNKEHHHEKSHNNGQNSNV
PKNSFQNNKSQNHVQKSKVENQKVPVAQGSQHKSAAVNA

Gene-Specific Links for PFI1740c-a

General Sub-Cellular Localisation Links