ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1570c (DAP, M18AAP)

M18 aspartyl aminopeptidase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during ring and schizont
not food vacuole and not nucleus

Who localised this protein by microscopy?

Dalal, S., Klemba, M.
Roles for two aminopeptidases in vacuolar hemoglobin catabolism in Plasmodium falciparum. (2007 Dec 7, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol and not food vacuole and not nucleus

Teuscher, F., Lowther, J., Skinner-Adams, T. S., Spielmann, T., Dixon, M. W., Stack, C. M., Donnelly, S., Mucha, A., Kafarski, P., Vassiliou, S., Gardiner, D. L., Dalton, J. P., Trenholme, K. R.
The M18 aspartyl aminopeptidase of the human malaria parasite Plasmodium falciparum. (2007 Oct 19, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol during ring and schizont
  • "Immunofluorescence analysis of parasite-infected erythrocytes using anti-PfM18AAP antibody located the PfM18AAP enzyme to the parasite cytosol (Fig. 4A)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to whole protein, GFP tag
  • Strain: D10
  • Gene model mapping comments: taken directly from publication, annotation matches
  • Localisation record: cytosol during ring and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11420

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI1570c M18 aspartyl aminopeptidase
MDKKAREYAQDALKFIQRSGSNFLACKNLKERLENNGFINLSEGETWNLNKNEGYVLCKENRNICGFFVGKNFNIDTGSI
LISIGHIDSCALKISPNNNVIKKKIHQINVECYGSGLWHTWFDRSLGLSGQVLYKKGNKLVEKLIQINKSVLFLPSLAIH
LQNRTRYDFSVKINYENHIKPIISTTLFNQLNKCKRNNVHHDTILTTDTKFSHKENSQNKRDDQMCHSFNDKDVSNHNLD
KNTIEHLTNQQNEEKNKHTKDNPNSKDIVEHINTDNSYPLLYLLSKELNCKEEDILDFELCLMDTQEPCFTGVYEEFIEG
ARFDNLLGSFCVFEGFIELVNSIKNHTSNENTNHTNNITNDINDNIHNNLYISIGYDHEEIGSLSEVGARSYCTKNFIDR
IISSVFKKEIHEKNLSVQEIYGNLVNRSFILNVDMAHCSHPNYPETVQDNHQLFFHEGIAIKYNTNKNYVTSPLHASLIK
RTFELYYNKYKQQIKYQNFMVKNDTPCGSTVGSMVAANLSMPGIDIGIPQLAMHSIREIAAVHDVFFLIKGVFAFYTYYN
QVLSTCVHDK

Gene-Specific Links for PFI1570c

General Sub-Cellular Localisation Links