ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1475w (MSP1, MSP-1, msp1 unprocessed, msp1, Msp-1 19, MSP1 19)

merozoite surface protein 1, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during after rupture and early ring and late schizont and merozoite and ring and schizont and trophozoite
microneme during late schizont
merozoite surface during merozoite and schizont
during gametocyte and merozoite and schizont
food vacuole and not parasite plasma membrane during late ring
not apical during merozoite
not under parasite plasma membrane during schizont and trophozoite
residual body membrane during after rupture and schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

merozoite surface

Raj, D. K., Mu, J., Jiang, H., Kabat, J., Singh, S., Sullivan, M., Fay, M. P., McCutchan, T. F., Su, X. Z.
Disruption of a Plasmodium falciparum multidrug resistance-associated protein (PfMRP) alters its fitness and transport of antimalarial drugs and glutathione. (2009 Mar 20, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "To further characterize the protein expression patterns and localization of PfMRP in different developmental stages, we performed immunofluorescent assay using antibodies against PfMRP, PfMSP-1 (a protein on merozoite plasma membrane), PfCRT (on food vacuole membrane), and PfMDV-1 (gametocyte-specific)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: plasma membrane during merozoite
  • Other genes localised in this publication: ABC transporter, (CT family), putative, chloroquine resistance transporter, male development gene 1

Gao, Y. H., Li, H. L., Lu, Y., Gao, F. M., Lin, Y. H., Zhou, H. C., Zhang, L. H., Wang, H.
Identification of a vaccine candidate antigen, PfMAg-1, from Plasmodium falciparum with monoclonal antibody M26-32. (2009 Nov, Parasitol Res) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "The 19-kDa C-terminal fragment of PfMSP-1, PfMSP-119, remains membrane-bound on the invading merozoite (Blackman et al. 1990)"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: ag-1 blood stage membrane protein homologue, merozoite surface protein 4

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

merozoite surface and not apical during merozoite, parasite plasma membrane during schizont and trophozoite, not under parasite plasma membrane during schizont and trophozoite

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during ring and schizont and trophozoite

Wickramarachchi, T., Cabrera, A. L., Sinha, D., Dhawan, S., Chandran, T., Devi, Y. S., Kono, M., Spielmann, T., Gilberger, T. W., Chauhan, V. S., Mohmmed, A.
A novel Plasmodium falciparum erythrocyte binding protein associated with the merozoite surface, PfDBLMSP. (2009 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "(F) Co-localization studies of GFP fusion proteins with the surface marker MSP-1 by immunofluorescence"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Comment: PMID is also 19640465
  • Other genes localised in this publication: duffy binding-like merozoite surface protein, erythrocyte binding antigen-175

de Koning-Ward, T. F., Gilson, P. R., Boddey, J. A., Rug, M., Smith, B. J., Papenfuss, A. T., Sanders, P. R., Lundie, R. J., Maier, A. G., Cowman, A. F., Crabb, B. S.
A newly discovered protein export machine in malaria parasites. (2009 Jun 18, Nature) PubMed / full text
   more detail about this publication

parasite plasma membrane during ring
  • "Immunofluorescence analysis (IFA) showed that PTEX150 and HSP101 co-localize and are found in discrete foci in the membranes surrounding the ring-stage parasite (Fig. 1d). This membrane is the PVM, as fluorescence surrounds the parasite membrane marker MSP1(19). "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during ring
  • Other genes localised in this publication: translocon component PTEX150, heat shock protein 101, exported protein 2

Gilson, P. R., O'Donnell, R. A., Nebl, T., Sanders, P. R., Wickham, M. E., McElwain, T. F., de Koning-Ward, T. F., Crabb, B. S.
MSP1(19) miniproteins can serve as targets for invasion inhibitory antibodies in Plasmodium falciparum provided they contain the correct domains for cell surface trafficking. (2008 Apr, Mol Microbiol) PubMed / full text
   more detail about this publication

merozoite surface
  • "Localization of MSP-119 expressed by the D10-PcM19 transfected parasites by IFA indicates the MSP1 miniprotein colocalizes with the endogenous MSP-1 protein on the plasma membrane."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, GFP tag
  • Strain: D10, 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: merozoite surface
  • Other genes localised in this publication: -

Kadekoppala, M., O'Donnell, R. A., Grainger, M., Crabb, B. S., Holder, A. A.
Deletion of the Plasmodium falciparum merozoite surface protein 7 gene impairs parasite invasion of erythrocytes. (2008 Dec, Eukaryot Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during late schizont
  • "Absence of MSP7 does not alter expression and distribution of several other peripheral merozoite surface proteins. In addition to MSP7, several other proteins have been reported to interact with the MSP1 complex through protein-protein interactions. We investigated expression and distribution of MSP3, MSP6, and MSP9 (ABRA) and a parasitophorous vacuolar protein, SERA-5, in order to examine the consequence of altering the nature of the MSP1 complex."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: D10
  • Gene model mapping comments: annotation matches
  • Localisation record: surface during late schizont
  • Other genes localised in this publication: merozoite surface protein 3, merozoite surface protein 6, merozoite surface protein 9, serine repeat antigen 5

Green, J. L., Rees-Channer, R. R., Howell, S. A., Martin, S. R., Knuepfer, E., Taylor, H. M., Grainger, M., Holder, A. A.
The motor complex of Plasmodium falciparum: phosphorylation by a calcium-dependent protein kinase. (2008 Nov 7, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane and residual body membrane during after rupture and schizont
  • "CDPK1 colocalizes with MTIP around developing merozoites in segmented schizonts but is also present in membranes around the mature food vacuole/residual body of the schizonts, whereas MTIP is absent (Fig. 2B, panel i). CDPK1 and MSP1 colocalize entirely."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PPM and residual body membrane during schizont and following schizont rupture
  • Other genes localised in this publication: calcium dependent protein kinase 1, myosin A tail domain interacting protein, chloroquine resistance transporter

Mphande, F. A., Ribacke, U., Kaneko, O., Kironde, F., Winter, G., Wahlgren, M.
SURFIN4.1, a schizont-merozoite associated protein in the SURFIN family of Plasmodium falciparum. (2008, Malar J) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite

Li, X., Chen, H., Oh, S. S., Chishti, A. H.
A Presenilin-like protease associated with Plasmodium falciparum micronemes is involved in erythrocyte invasion. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "Indirect immunofluorescence microscopy using specific antibodies showed PfSPP is co-localized with EBA-175 (a microneme protein), but neither with RAP1 (a rhoptry marker) nor MSP1 (merozoite surface protein) in the P. falciparum (3D7) schizonts."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: signal peptide peptidase, rhoptry-associated protein 1, erythrocyte binding antigen-175

Wickramarachchi, T., Devi, Y. S., Mohmmed, A., Chauhan, V. S.
Identification and characterization of a novel Plasmodium falciparum merozoite apical protein involved in erythrocyte binding and invasion. (2008, PLoS One) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite

Philip, N., Haystead, T. A.
Characterization of a UBC13 kinase in Plasmodium falciparum. (2007 May 8, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

merozoite surface during schizont
  • "MSP1 is a marker for the plasma membrane a structure that exists just within the PVM."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: merozoite surface during schizont
  • Other genes localised in this publication: serine/threonine protein kinase, circumsporozoite-related antigen

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite

Yeoh, S., O'Donnell, R. A., Koussis, K., Dluzewski, A. R., Ansell, K. H., Osborne, S. A., Hackett, F., Withers-Martinez, C., Mitchell, G. H., Bannister, L. H., Bryans, J. S., Kettleborough, C. A., Blackman, M. J.
Subcellular discharge of a serine protease mediates release of invasive malaria parasites from host erythrocytes. (2007 Dec 14, Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during ring

Pal-Bhowmick, I., Mehta, M., Coppens, I., Sharma, S., Jarori, G. K.
Protective properties and surface localization of Plasmodium falciparum enolase. (2007 Nov, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "Therefore, we studied the localization of enolase in mature segmented schizonts of P. falciparum along with a known merozoite surface marker, merozoite surface protein 1 (MSP-1) (Fig. 2D)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: enolase

Sanders, P. R., Kats, L. M., Drew, D. R., O'Donnell, R. A., O'Neill, M., Maier, A. G., Coppel, R. L., Crabb, B. S.
A set of glycosylphosphatidyl inositol-anchored membrane proteins of Plasmodium falciparum is refractory to genetic deletion. (2006 Jul, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "Colocalization of MSP-1 and MSP-5 is evident upon merging of images."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: merozoite surface protein 5

O'Donnell, R. A., Hackett, F., Howell, S. A., Treeck, M., Struck, N., Krnajski, Z., Withers-Martinez, C., Gilberger, T. W., Blackman, M. J.
Intramembrane proteolysis mediates shedding of a key adhesin during erythrocyte invasion by the malaria parasite. (2006 Sep 25, J Cell Biol) PubMed / full text
   more detail about this publication

parasite plasma membrane during ring
  • "PfROM1 remains exclusively in an apical location; it could not be detected at the merozoite surface (Fig. S3, C and D) and did not colocalize with the plasma membrane marker MSP119 in rings (Fig. S3 E)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PM during ring
  • Other genes localised in this publication: rhomboid protease ROM4, erythrocyte binding antigen-175

Eksi, S., Haile, Y., Furuya, T., Ma, L., Su, X., Williamson, K. C.
Identification of a subtelomeric gene family expressed during the asexual-sexual stage transition in Plasmodium falciparum. (2005 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during gametocyte
  • "The parasites were then dual labeled with rabbit IgG antibodies generated against MSP1 (MR4/ATCC, Manassas, VA), a marker for all early stage parasites, or Pfs16, a marker for gametocytes, and mouse IgG antibodies generated against Pfg14.744 (744) or Pfg14.748 (748) followed by fluorescein isothiocyanate (FITC)-labeled anti-rabbit IgG and tetramethylrhodamine isothiocyanate (TRITC)-labeled anti-mouse IgG. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during gametocyte
  • Other genes localised in this publication: Plasmodium exported protein, unknown function, Plasmodium exported protein (PHISTa), unknown function, sexual stage-specific protein precursor

Mohmmed, A., Kishore, S., Patra, K. P., Dasaradhi, P. V., Malhotra, P., Chauhan, V. S.
Identification of karyopherin beta as an immunogenic antigen of the malaria parasite using immune mice and human sera. (2005 May, Parasite Immunol) PubMed / full text
   more detail about this publication

during merozoite and schizont
  • "Schizonts and merozoites were also immunostained with anti-MSP1 antibodies (green); "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during schizont and merozoite
  • Other genes localised in this publication: karyopherin beta

Drew, D. R., Sanders, P. R., Crabb, B. S.
Plasmodium falciparum merozoite surface protein 8 is a ring-stage membrane protein that localizes to the parasitophorous vacuole of infected erythrocytes. (2005 Jul, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during early ring and late schizont, food vacuole and not parasite plasma membrane during late ring
  • " In late-ring-stage parasites, anti-PfMSP-119 antibodies did not stain the circumference of parasites, and staining was limited to a discrete point in the parasite cytoplasm adjacent to the nascent hemazoan crystal, suggesting that PfMSP-119 is located in the food vacuole at this time. In late-schizont-stage parasites, PfMSP-119 antibody stained the circumference of individual merozoites within the maturing parasite, which is consistent with the known localization of newly synthesized PfMSP-1 on the merozoite surface."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Discrete dots on PPM during early ring, FV and not circumference during late ring, circumference during late schizont
  • Other genes localised in this publication: merozoite surface protein 8,ring-stage membrane protein 1

Kumar, A., Vaid, A., Syin, C., Sharma, P.
PfPKB, a novel protein kinase B-like enzyme from Plasmodium falciparum: I. Identification, characterization, and possible role in parasite development. (2004 Jun 4, J Biol Chem) PubMed / full text
   more detail about this publication

merozoite surface
  • "PfPKB exhibited a diffused staining pattern in segmented schizonts, indicating its presence in the cytoplasm, and also exhibited some co-localization with MSP1 (Fig. 6F). In free merozoites PfPKB seems to be localized at the apical end (Fig. 6G), a region that is important for erythrocyte invasion. PfPKB also co-localizes with EBA175, a micronemal protein (data not shown)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: merozoite surface
  • Other genes localised in this publication: RAC-beta serine/threonine protein kinase

Black, C. G., Wang, L., Wu, T., Coppel, R. L.
Apical location of a novel EGF-like domain-containing protein of Plasmodium falciparum. (2003 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite

Miller, S. K., Good, R. T., Drew, D. R., Delorenzi, M., Sanders, P. R., Hodder, A. N., Speed, T. P., Cowman, A. F., de Koning-Ward, T. F., Crabb, B. S.
A subset of Plasmodium falciparum SERA genes are expressed and appear to play an important role in the erythrocytic cycle. (2002 Dec 6, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during late schizont
  • "Furthermore, SERA4 also appeared to co-localize with the membrane-anchored merozoite surface protein 1(MSP-1) in mature (segmented) schizonts, also consistent with a parasitophorous vacuole location for SERA4 (Fig. 7B)."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: parasite membrane during segmented schizont
  • Other genes localised in this publication: serine repeat antigen 5, serine repeat antigen 4

Healer, J., Crawford, S., Ralph, S., McFadden, G., Cowman, A. F.
Independent translocation of two micronemal proteins in developing Plasmodium falciparum merozoites. (2002 Oct, Infect Immun) PubMed / full text
   more detail about this publication

microneme during late schizont
  • "FIG. 2. Single and dual indirect immunofluorescence images showing the same subcellular localization of AMA1 and EBA-175 in two mature schizonts of P. falciparum. "
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during mature schizont
  • Other genes localised in this publication: erythrocyte binding antigen-175

Trucco, C., Fernandez-Reyes, D., Howell, S., Stafford, W. H., Scott-Finnigan, T. J., Grainger, M., Ogun, S. A., Taylor, W. R., Holder, A. A.
The merozoite surface protein 6 gene codes for a 36 kDa protein associated with the Plasmodium falciparum merozoite surface protein-1 complex. (2001 Jan 15, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during merozoite
  • "The antigen was detected in mature schizonts around merozoites, and the pattern was indistinguishable from that obtained using mAbs specific for MSP-1 (Fig. 3)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: T9/96
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during merozoite
  • Other genes localised in this publication: merozoite surface protein 6

Orthology

OrthoMCL

Part of OrthoMCL group OG4_37556

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI1475w merozoite surface protein 1
MKIIFFLCSFLFFIINTQCVTHESYQELVKKLEALEDAVLTGYSLFQKEKMVLNEEEITTKGASAQSGASAQSGASAQSG
ASAQSGASAQSGASAQSGTSGPSGPSGTSPSSRSNTLPRSNTSSGASPPADASDSDAKSYADLKHRVRNYLFTIKELKYP
ELFDLTNHMLTLCDNIHGFKYLIDGYEEINELLYKLNFYFDLLRAKLNDVCANDYCQIPFNLKIRANELDVLKKLVFGYR
KPLDNIKDNVGKMEDYIKKNKTTIANINELIEGSKKTIDQNKNADNEEGKKKLYQAQYDLSIYNKQLEEAHNLISVLEKR
IDTLKKNENIKKLLDKINEIKNPPPANSGNTPNTLLDKNKKIEEHEEKIKEIAKTIKFNIDSLFTDPLELEYYLREKNKK
VDVTPKSQDPTKSVQIPKVPYPNGIVYPLPLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKKK
IDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKIFSARYTYNVEKQRYNNKFSSSNNSVYN
VQKLKKALSYLEDYSLRKGISEKDFNHYYTLKTGLEADIKKLTEEIKSSENKILEKNFKGLTHSANGSLEVSDIVKLQVQ
KVLLIKKIEDLRKIELFLKNAQLKDSIHVPNIYKPQNKPEPYYLIVLKKEVDKLKEFIPKVKDMLKKEQAVLSSITQPLV
AASETTEDGGHSTHTLSQSGETEVTEETEETEETVGHTTTVTITLPPTQPSPPKEVKVVENSIEHKSNDNSQALTKTVYL
KKLDEFLTKSYICHKYILVSNSSMDQKLLEVYNLTPEEENELKSCDPLDLLFNIQNNIPAMYSLYDSMNNDLQHLFFELY
QKEMIYYLHKLKEENHIKKLLEEQKQITGTSSTSSPGNTTVNTAQSATHSNSQNQQSNASSTNTQNGVAVSSGPAVVEES
HDPLTVLSISNDLKGIVSLLNLGNKTKVPNPLTISTTEMEKFYENILKNNDTYFNDDIKQFVKSNSKVITGLTETQKNAL
NDEIKKLKDTLQLSFDLYNKYKLKLDRLFNKKKELGQDKMQIKKLTLLKEQLESKLNSLNNPHNVLQNFSVFFNKKKEAE
IAETENTLENTKILLKHYKGLVKYYNGESSPLKTLSEVSIQTEDNYANLEKFRVLSKIDGKLNDNLHLGKKKLSFLSSGL
HHLITELKEVIKNKNYTGNSPSENNKKVNEALKSYENFLPEAKVTTVVTPPQPDVTPSPLSVRVSGSSGSTKEETQIPTS
GSLLTELQQVVQLQNYDEEDDSLVVLPIFGESEDNDEYLDQVVTGEAISVTMDNILSGFENEYDVIYLKPLAGVYRSLKK
QIEKNIFTFNLNLNDILNSRLKKRKYFLDVLESDLMQFKHISSNEYIIEDSFKLLNSEQKNTLLKSYKYIKESVENDIKF
AQEGISYYEKVLAKYKDDLESIKKVIKEEKEKFPSSPPTTPPSPAKTDEQKKESKFLPFLTNIETLYNNLVNKIDDYLIN
LKAKINDCNVEKDEAHVKITKLSDLKAIDDKIDLFKNPYDFEAIKKLINDDTKKDMLGKLLSTGLVQNFPNTIISKLIEG
KFQDMLNISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADATCTEEDSGSSRKKI
TCECTKPDSYPLFDGIFCSSSNFLGISFLLILMLILYSFI

Gene-Specific Links for PFI1475w

General Sub-Cellular Localisation Links