ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1445w (RhopH2)

high molecular weight rhoptry protein 2, a gene from Plasmodium falciparum

Compiled localisation
rhoptry during extracellular merozoite and late schizont and schizont
not microneme during extracellular merozoite and late schizont and schizont
parasite plasma membrane during ring

Who localised this protein by microscopy?

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry during late schizont

Yeoh, S., O'Donnell, R. A., Koussis, K., Dluzewski, A. R., Ansell, K. H., Osborne, S. A., Hackett, F., Withers-Martinez, C., Mitchell, G. H., Bannister, L. H., Bryans, J. S., Kettleborough, C. A., Blackman, M. J.
Subcellular discharge of a serine protease mediates release of invasive malaria parasites from host erythrocytes. (2007 Dec 14, Cell) PubMed / full text
   more detail about this publication

rhoptry during schizont
  • "(A) Schizonts of 3D7SUB1HA3 clone C10 dual-labeled with the anti-HA mAb 3F10 (HA; green) plus mAb 61.3 (RhopH2; rhoptries, Ling etal., 2003), mAb 4G2 (PfAMA1; micronemes, Harris etal., 2005), or mAb 28/2 (RESA; dense granules, (Aikawa etal., 1990)."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptries during schizont
  • Other genes localised in this publication: subtilisin-like protease 1, apical membrane antigen 1, ring-infected erythrocyte surface antigen, merozoite surface protein 1

O'Keeffe, A. H., Green, J. L., Grainger, M., Holder, A. A.
A novel Sushi domain-containing protein of Plasmodium falciparum. (2005 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry and not microneme during schizont
  • "Double staining immunofluorescence assays (IFA) of 3D7 schizonts showed the staining pattern of the anti-ASP antibodies to be indistinguishable from that of the monoclonal antibody 4G2 that binds to AMA-1 in micronemes [18 (Fig. 5A) but they were distinct from that of antibody specific for the rhoptry protein, RhopH2 [16 (Fig. 5B). "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry and not microneme during schizont
  • Other genes localised in this publication: apical sushi protein, apical membrane antigen 1

Kaneko, O., Yim Lim, B. Y., Iriko, H., Ling, I. T., Otsuki, H., Grainger, M., Tsuboi, T., Adams, J. H., Mattei, D., Holder, A. A., Torii, M.
Apical expression of three RhopH1/Clag proteins as components of the Plasmodium falciparum RhopH complex. (2005 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during late schizont
  • "Overlaid images of the double-staining for anti-Clag3.1 and anti-PfRhopH2 or anti-Clag3.1 and anti-Clag9 sera reacting with segmented schizonts showed indistinguishable patterns of localization for these proteins (Fig. 5AB). RhopH2 and Clag9 were previously shown to be located within the rhoptry body by immunoelectron microscopy [18, thus our IFA data suggest that Clag3.1 is localized within the rhoptries of segmented schizonts. Overlaid images of the double-staining for Clag2 and -3.1 also showed an indistinguishable pattern (Fig. 5C), indicating that Clag2 is also localized within the rhoptries of segmented schizonts."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during segmented schizont
  • Other genes localised in this publication: cytoadherence linked asexual protein 9, cytoadherence linked asexual protein 3.2, cytoadherence linked asexual protein 2

Ling, I. T., Kaneko, O., Narum, D. L., Tsuboi, T., Howell, S., Taylor, H. M., Scott-Finnigan, T. J., Torii, M., Holder, A. A.
Characterisation of the rhoph2 gene of Plasmodium falciparum and Plasmodium yoelii. (2003 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during schizont, parasite plasma membrane during ring
  • "Each antibody bound to P. falciparum schizonts gave a distinctive punctate pattern typical of the apical proteins, and bound to ring stage parasites clearly outlining the parasite within the erythrocyte"
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody 4E10 directly to protein, polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from AY170391, annotation matches, RACE done, inconsistent UTR, taken directly from 17553576, annotation matches
  • Localisation record: rhoptry during schizont, parasite surface during ring
  • Comment: strain information not found
  • Other genes localised in this publication: -

Blair, P. L., Kappe, S. H., Maciel, J. E., Balu, B., Adams, J. H.
Plasmodium falciparum MAEBL is a unique member of the ebl family. (2002 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry and not microneme during extracellular merozoite and late schizont

Kaneko, O., Mu, J., Tsuboi, T., Su, X., Torii, M.
Gene structure and expression of a Plasmodium falciparum 220-kDa protein homologous to the Plasmodium vivax reticulocyte binding proteins. (2002 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during extracellular merozoite and schizont
  • "Double staining with rabbit anti-EBA-175 serum or rabbit anti-Pf140-kDa rhoptry protein (PfRhopH2) serum showed the localization of PfRH4 was distinct from that of PfRhopH2, the authentic rhoptry protein, but undistinguishable from that of EBA-175, the authentic microneme protein (Fig. 2B) in schizonts and released merozoite"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during schizont and released merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: reticulocyte binding protein homologue 4, erythrocyte binding antigen-175

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42859

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI1445w high molecular weight rhoptry protein 2
MIKVTIFLLLSIFSFNLYGLELNEKVSIKYGAEQGVGSADSNTKLCSDILKYLYMDEYLSEGDKATFEKKCHNVIGNIRN
TFSNKNTIKEGNEFLMSILHMKSLYGNNNNNNAGSESDVTLKSLYLSLKGSQNTEGESEVPSDDEINKTIMNFVKFNKYL
LDNSNDIKKVHDFLVLTSQSNENLLPNKEKLFEQIVDQIKYFDEYFFASGGKIKVKKGYLKYNFLDIYKQPVCSAYLHLC
SRYYESVSIYIRLKKVFNGIPAFLDKNCRKVKGEEFKKLMDMELKHNHIVERFDKYIISDDLYYVNMKVFDLKNVDKIQV
SKIDDINNLNIYEHKETMHLSAKNLSRYIDIKKELNDEKAYKQLMSAIRKYVTTLTKADSDITYFVKQLDDEEIERFLID
LNFFLYNGFLRITEDKHLINADDVSPSYINLYRSNNIVALYILKTQYEENKLSEYRAHKFYRRKRVSNITNDMIKKDFTQ
TNALTNLPNLDNKKTTEYYLKEYENFVENFQPDLHDIMKLQLFFTMAFKDCNVNQNFTETSKKLWFDLLYAYDKFGWFYI
HPNEVINSINKTDFVRHVLVSRNFLLKNNDQLTFLETQVAKIVEIINLSLEVDKSPDSLDFSIPMNFFNHKNGYHVMNDD
KLKLLTSYEYIDSIANNYFFLSEYKNDVFRTGNNFKLYFNLPNIYSLAYQLFNELAININVITNVPLKKYLKYNASYAYF
TLMNMIGKNHDIYSKGSRFVYASYILGLVFFIESHIDIARLKPKDFFFMKQSLPIIDHVYHKDLKTLKKNCTLLTDFMKI
NKNSQNYSLTHTEEMIKILGLLTVTLWAKEGKKSVYYDDDVSLYRKLMVSCVFNGGETIQEKLANNIEKSCDISQYGIKS
KNLKDMIDINLSIHKWNPAEIEKLAYSFVLSCKMQKLMYKPMNVEKLPLEDYYKLSLAPDMVKTYHCYKLGKQAAELLES
IILKKKFVRFRVTDAIDVYDFFYIKKVLSSRIKKEYNEFLQDKRAFEKKELETILNNSPFSEEQTMKLINSYECHWFTSY
ENFRILWMHASSNLGTGTYLKNFFSELWQNIRFLFKSKLKIRDMEYFSGDISQMNLLDYYSPMVHSESHCQEKMQVLFIT
LRDSKEENRSEIAQKVKSAYYQCKLDYYKNHHSDFIHRIHPNDFLNNKVYVLKQPYYLMSNVPLNNPKKVSRLFVTEGTL
EYLLLDKINIPECFGPCTKLHFNKVVIKESKQRIYDMTINNALVPEIQPYNRRKYMTIYINEAYIKNIVSDALTSEEIKR
HDIQKGNIKICMGKSTYLTEPILTEEHFNLTHKPVYDFSSVKHNLKVFHMKNEHLVSEDPNDDCFINYPLATINLDISDP
YKEISEDLIKNLYILKSS

Gene-Specific Links for PFI1445w

General Sub-Cellular Localisation Links