ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1260c (HDAC1)

histone deacetylase, a gene from Plasmodium falciparum

Compiled localisation
nucleus during schizont and segmenter and trophozoite

Who localised this protein by microscopy?

Joshi, M. B., Lin, D. T., Chiang, P. H., Goldman, N. D., Fujioka, H., Aikawa, M., Syin, C.
Molecular cloning and nuclear localization of a histone deacetylase homologue in Plasmodium falciparum. (1999 Mar 15, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus during schizont and segmenter and trophozoite
  • "The electron micrograph revealed the predominant nuclear localization of PfHDAC1 in the asexual blood stages of P. falciparum (Fig. 5). The reactivity of the antisera was strongest in the nuclei of segmenter (Fig. 5, panel B) followed by schizonts and trophozoites, and the least, in rings (data not shown)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein against epitope 428-445
  • Strain: FCR3
  • Gene model mapping comments: Blast from AF091326, annotation matches
  • Localisation record: Nucleus during segmenter and troph and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10203

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI1260c histone deacetylase
MSNRKKVAYFHDPDIGSYYYGAGHPMKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNELTLFHDYEYIDFLSSISLENY
REFTYQLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGASKLNHHCADICVNWSGGLHHAKMSEASGFCYINDIVLGILE
LLKYHARVMYIDIDVHHGDGVEEAFYVTHRVMTVSFHKFGDYFPGTGDITDVGVNHGKYYSVNVPLNDGMTDDAFVDLFK
VVIDKCVQTYRPGAIIIQCGADSLTGDRLGRFNLTIKGHARCVEHVRSYNIPLLVLGGGGYTIRNVSRCWAYETGVVLNK
HHEMPDQISLNDYYDYYAPDFQLHLQPSNIPNYNSPEHLSRIKMKIAENLRHIEHAPGVQFSYVPPDFFNSDIDDESDKN
QYELKDDSGGGRAPGTRAKEHSTTHHLRRKNYDDDFFDLSDRDQSIVPY

Gene-Specific Links for PFI1260c

General Sub-Cellular Localisation Links