ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1195c (TPK)

thiamine pyrophosphokinase, a gene from Plasmodium falciparum

Compiled localisation
cytosol during trophozoite

Who localised this protein by microscopy?

Eschbach, M. L., Muller, I. B., Gilberger, T. W., Walter, R. D., Wrenger, C.
The human malaria parasite Plasmodium falciparum expresses an atypical N-terminally extended pyrophosphokinase with specificity for thiamine. (2006 Dec, Biol Chem) PubMed / full text
   more detail about this publication

cytosol during trophozoite
  • "To verify the location of the parasite TPK within the cell, immunofluorescence analyses were performed. Co-staining of PfTPK with a GFP marker visualised its cytosolic localisation."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: Blast from AM229722, annotation mathes
  • Localisation record: Cytosol during troph
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11595

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI1195c thiamine pyrophosphokinase
MKKKYPYIFKMISLKYFSYFKKGPKVSCGNKERMTKNHKHHYSTIKEKDDFPHYHNLDFMKYIFSNNNKDKAQDIKISTS
VDNTNPNVCTDIYNYKLITIILNNTLCSHSYEIIKNSNILICADGGANRLYDLCCTMNEQHVSNYCINNNRSFVQGMELN
KNDYKKEEMKKRGKQDISNPIIQHTNDKNVTSKQLYDLFNNNHKLTINVDTKKRKENRDYSVEILPDFICGDFDSIYPHV
YKHYKNKGVLFEKCQNQENTDLDKCIEKIKPYIYENDKILVLGATGNRFDQTCANISSLYKNVQTINNIYLIGENNFIFL
LKKGNHVIQINLNAFQKGCALLPIGGKCKVKTEGLKYNLNYEYLSFDSLISSSNEIIQNEIKISNDTPLIWNSQLKNEEF

Gene-Specific Links for PFI1195c

General Sub-Cellular Localisation Links