ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI1160w (LplA2)

lipoate protein ligase a type 2, a gene from Plasmodium falciparum

Compiled localisation
apicoplast and mitochondrion during merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

Gunther, S., Wallace, L., Patzewitz, E. M., McMillan, P. J., Storm, J., Wrenger, C., Bissett, R., Smith, T. K., Muller, S.
Apicoplast lipoic acid protein ligase B is not essential for Plasmodium falciparum. (2007 Dec, PLoS Pathog) PubMed / full text
   more detail about this publication

apicoplast and mitochondrion during merozoite and ring and schizont and trophozoite
  • "Localisation studies show that LplA2 is present in both mitochondrion and apicoplast suggesting redundancy between the lipoic acid protein ligases in the erythrocytic stages of P. falciparum."
  • Microscopy type: Light
  • Microscopy method: GFP tag, antibody
  • Strain: 3D7
  • Gene model mapping comments: Blast from DQ400341, annotation matches
  • Localisation record: mitochondrion and apicoplast during erythrocytic stages
  • Other genes localised in this publication: lipoamide dehydrogenase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_19050

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PFI1160w lipoate protein ligase a type 2
MRIIKCLDQIFRPVLPNVNINNIQKNKKINILYFIDVSKFHVFEQLLLEESLFRISNNTTEGLNNIGFVIVNNTCEEMNE
SKGNECIFNNKKCVILGISNKIKDHIKDTNYIKENKISLIKRFTGGGTIYINKNSLLVSLILPHKFEKNKKIYPSNITEW
SYNYFYNTSKQIYDKTQINNEKNSLNKNHILFNQYFNYYENDYVYKDYDEHNKNIILKKVGGNAQSFARNYFVHHTSYIW
TCDYKEMNNILLNPSKQPIYRNKRKHQHFLQSIKLCLHDDIHTPNIFIEKLIKHIKHIINYKNITDQHDYWFFNKINLKN
INDHILRNSEHFDDIYVADMNLLQCIFNYYNNSSLFNNMRSTYFLDLEGKKVSDRYYDIPTYFL

Gene-Specific Links for PFI1160w

General Sub-Cellular Localisation Links