ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0930c (NAPS, NapS)

nucleosome assembly protein, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm during early ring and extracellular merozoite and gametocyte stage ii and gametocyte stage v and late ring and schizont and trophozoite
far nuclear periphery
nucleus during gametocyte stage iii-iv and late trophozoite and merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

Gill, J., Kumar, A., Yogavel, M., Belrhali, H., Jain, S. K., Rug, M., Brown, M., Maier, A. G., Sharma, A.
Structure, localization and histone binding properties of nuclear-associated nucleosome assembly protein from Plasmodium falciparum. (2010, Malar J) PubMed / full text
   more detail about this publication

nucleus during late trophozoite and merozoite and ring and schizont and trophozoite
  • "The protein chimeras showed a nuclear localization in all stages of erythrocytic life-cycle as determined by co-localization with the nuclear stain DAPI (4', 6-diamidino-2-phenylindole; nuclear stain) (Figure 3a, c-f)."
  • Microscopy type: live light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus during merozoite and ring and trophozoite and late trophozoite and schizont
  • Other genes localised in this publication: -

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

far nuclear periphery

Gupta, A., Mehra, P., Nitharwal, R., Sharma, A., Biswas, A. K., Dhar, S. K.
Analogous expression pattern of Plasmodium falciparum replication initiation proteins PfMCM4 and PfORC1 during the asexual and sexual stages of intraerythrocytic developmental cycle. (2006 Aug, FEMS Microbiol Lett) PubMed / full text
   more detail about this publication

nucleus during gametocyte stage iii-iv

Chandra, B. R., Olivieri, A., Silvestrini, F., Alano, P., Sharma, A.
Biochemical characterization of the two nucleosome assembly proteins from Plasmodium falciparum. (2005 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm during early ring and extracellular merozoite and gametocyte stage ii and gametocyte stage v and late ring and schizont and trophozoite
  • "PfNAPL was predominantly localised in the cytoplasm in asexual and sexual stages of the parasite. PfNAPS did not co-localise with PfNAPL and was more intimately associated with the parasite nucleus, most strikingly in P. falciparum gametocytes."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7A
  • Gene model mapping comments: Taken directly from paper, annotated wrongly (by typo) in paper as PF1093c, length matches
  • Localisation record: Cytoplasm during early ring and late ring and troph and schizont and free merozoite and stage V gametocytes and stage II gametocyte
  • Other genes localised in this publication: nucleosome assembly protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13064

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI0930c nucleosome assembly protein
MKRDRSENSVENTDPKHTKIENDDPLMPFMQDFEDIQKDIEQLDIKCAHEQMNIQKQYDEKKKPLFEKRDEIIQKIPGFW
ANTLRKHPALSDIVPEDIDILNHLVKLDLKDNMDNNGSYKITFIFGEKAKEFMEPLTLVKHVTFDNNQEKVVECTRIKWK
EGKNPIAAVTHNRSDLDNEIPKWSIFEWFTTDELQDKPDVGELIRREIWHNPLSYYLGLEEFDEFDDDFDEEFDDDDDDD
DDDDDDDDDDDKDDDLDGDDDGNNDDNDD

Gene-Specific Links for PFI0930c

General Sub-Cellular Localisation Links