ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0880c (GAP50, SAP)

glideosome-associated protein 50,secreted acid phosphatase, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during extracellular merozoite and schizont
not parasitophorous vacuole during extracellular merozoite and schizont
endoplasmic reticulum during early intraerythrocytic
food vacuole and periphery
apical during schizont
merozoite surface during late schizont

Who localised this protein by microscopy?

Yeoman, J. A., Hanssen, E., Maier, A. G., Klonis, N., Maco, B., Baum, J., Turnbull, L., Whitchurch, C. B., Dixon, M. W., Tilley, L.
Tracking Glideosome-associated protein 50 reveals the development and organization of the inner membrane complex of Plasmodium falciparum. (2011 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

endoplasmic reticulum during early intraerythrocytic, apical during schizont, merozoite surface during late schizont
  • "Full-length PfGAP50-GFP is located in the endoplasmic reticulum in early stage parasites, then redistributes to apical caps during the formation of daughter merozoites. In the final stage of schizogony the PfGAP50-GFP profile extends further around the merozoite surface."
  • Microscopy type: Fixed Light, 3D SIM, Live Light
  • Microscopy method: antibody, GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: endoplasmic reticulum during early stage parasites, apical cap during daughter merozoite formation, around merozoite surface during final stage of schizogony
  • Other genes localised in this publication: endoplasmic reticulum-resident calcium binding protein, glideosome-associated protein 45

Muller, I. B., Knockel, J., Eschbach, M. L., Bergmann, B., Walter, R. D., Wrenger, C.
Secretion of an acid phosphatase provides a possible mechanism to acquire host nutrients by Plasmodium falciparum. (2010 May 1, Cell Microbiol) PubMed / full text
   more detail about this publication

endoplasmic reticulum and food vacuole and periphery
  • "By means of live microscopy of parasites transfected with GFP-fusions of this secreted acid phosphatase (PfSAP), we demonstrate that PfSAP enters the secretory pathway en route to the parasite periphery - mediated by SA - and is subsequently engulfed into the food vacuole."
  • Microscopy type: Light
  • Microscopy method: GFP tag after 99 amino acids
  • Strain:
  • Gene model mapping comments: taken directly from publication
  • Localisation record: ER and periphery and food vacuole
  • Comment: stage information not found in publication
  • Comment: strain information not found
  • Other genes localised in this publication: -

Baum, J., Richard, D., Healer, J., Rug, M., Krnajski, Z., Gilberger, T. W., Green, J. L., Holder, A. A., Cowman, A. F.
A conserved molecular motor drives cell invasion and gliding motility across malaria life cycle stages and other apicomplexan parasites. (2006 Feb 24, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular merozoite and schizont, not parasitophorous vacuole during extracellular merozoite and schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13004

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI0880c glideosome-associated protein 50,secreted acid phosphatase
MNYCKTTFHIFFFVLFFITIYEIKCQLRFASLGDWGKDTKGQILNAKYFKQFIKNERVTFIVSPGSNFIDGVKGLNDPAW
KNLYEDVYSEEKGDMYMPFFTVLGTRDWTGNYNAQLLKGQGIYIEKNGETSIEKDADATNYPKWIMPNYWYHYFTHFTVS
SGPSIVKTGHKDLAAAFIFIDTWVLSSNFPYKKIHEKAWNDLKSQLSVAKKIADFIIVVGDQPIYSSGYSRGSSYLAYYL
LPLLKDAEVDLYISGHDNNMEVIEDNDMAHITCGSGSMSQGKSGMKNSKSLFFSSDIGFCVHELSNNGIVTKFVSSKKGE
VIYTHKLNIKKKKTLDKVNALQHFAALPNVELTDVPSSGPMGNKDTFVRVVGTIGILIGSVIVFIGASSFLSKNMK

Gene-Specific Links for PFI0880c

General Sub-Cellular Localisation Links