ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PFI0875w (grp, Hsp70-2, BiP)

heat shock protein 70, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum during early intraerythrocytic and early trophozoite and intraerythrocytic and late intraerythrocytic and late schizont and late trophozoite and ring and schizont and trophozoite
not nucleus
not golgi apparatus during intraerythrocytic
not apicoplast and not cis-golgi and not mitochondrion during early trophozoite and late schizont and late trophozoite

Who localised this protein by microscopy?

Ayong, L., DaSilva, T., Mauser, J., Allen, C. M., Chakrabarti, D.
Evidence for prenylation-dependent targeting of a Ykt6 SNARE in Plasmodium falciparum. (2011 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during trophozoite
  • "The GFP-PfYkt6.1 compartments were only partially labeled with antibodies against the Golgi marker PfErd2 (B), or the ER marker PfBip (C). "
  • Microscopy type: Fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during trophozoite
  • Other genes localised in this publication: SNARE protein, putative, ER lumen protein retaining receptor

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not nucleus

Downie, M. J., El Bissati, K., Bobenchik, A. M., Nic Lochlainn, L., Amerik, A., Zufferey, R., Kirk, K., Ben Mamoun, C.
PfNT2, a permease of the equilibrative nucleoside transporter family in the endoplasmic reticulum of Plasmodium falciparum. (2010 Jul 2, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and schizont and trophozoite
  • "Confocal and immunoelectron microscopy analyses of transgenic parasites harboring GFP or HA-tagged PfNT2 demonstrated endoplasmic reticulum localization. This localization was confirmed by colocalization with the endoplasmic reticulum marker PfBiP. "
  • Microscopy type: fixed Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during blood stages
  • Other genes localised in this publication: nucleoside transporter 2

Shastri, S., Zeeman, A. M., Berry, L., Verburgh, R. J., Braun-Breton, C., Thomas, A. W., Gannoun-Zaki, L., Kocken, C. H., Vial, H. J.
Plasmodium CDP-DAG synthase: an atypical gene with an essential N-terminal extension. (2010 Sep, Int J Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum
  • "PfCDS-N3TM–GFP was co-labeled with Bip, a marker of the endoplasmic reticulum (ER)."
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER
  • Comment: stage information not found in publication
  • Other genes localised in this publication: cytidine diphosphate-diacylglycerol synthase, serine repeat antigen 5

Parish, L. A., Rayner, J. C.
Plasmodium falciparum secretory pathway: characterization of PfStx1, a plasma membrane Qa-SNARE. (2009 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during schizont
  • "PfSyn1 (green) again has a peripheral location that is distinct from the ER marker PfBiP (in red) (C). "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during schizont
  • Other genes localised in this publication: syntaxin, Qa-SNARE family, merozoite surface protein 3

Gratraud, P., Huws, E., Falkard, B., Adjalley, S., Fidock, D. A., Berry, L., Jacobs, W. R. Jr, Baird, M. S., Vial, H., Kremer, L.
Oleic acid biosynthesis in Plasmodium falciparum: characterization of the stearoyl-CoA desaturase and investigation as a potential therapeutic target. (2009, PLoS One) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not apicoplast and not cis-golgi and not mitochondrion during early trophozoite and late schizont and late trophozoite
  • "As shown in Fig. 5B, PfSCD-GFP colocalized mostly with PfBiP and PfDSI (disulfide isomerase), two soluble ER markers [41], [43], therefore confirming the ER localization of PfSCD-GFP. In contrast, the GFP-tagged PfSCD protein did not colocalize with ERD2, a known marker of the cis-Golgi [41], [44]."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: endoplasmic reticulum and not cis-golgi and not apicoplast and not mitochondria during early trophozoite and late trophozoite and segmented schizont
  • Other genes localised in this publication: stearoyl-CoA delta 9 desaturase, putative, protein disulfide isomerase, ER lumen protein retaining receptor, acyl carrier protein

Struck, N. S., Herrmann, S., Schmuck-Barkmann, I., de Souza Dias, S., Haase, S., Cabrera, A. L., Treeck, M., Bruns, C., Langer, C., Cowman, A. F., Marti, M., Spielmann, T., Gilberger, T. W.
Spatial dissection of the cis- and trans-Golgi compartments in the malaria parasite Plasmodium falciparum. (2008 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and schizont and trophozoite

Lee, M. C., Moura, P. A., Miller, E. A., Fidock, D. A.
Plasmodium falciparum Sec24 marks transitional ER that exports a model cargo via a diacidic motif. (2008 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and schizont and trophozoite
  • "As PfSec12 did not appear to be distributed uniformly throughout the ER in all parasites, we compared the pattern of PfSec12 with that of GFPSDEL, which localizes throughout the general ER. GFPSDEL is targeted to the ER by virtue of a signal peptide that directs translocation into the ER lumen and a C-terminal SDEL motif that mediates retrieval from the Golgi, resulting in colocalization with the ER chaperone BiP (van Dooren etal., 2005)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Dd2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during ring and troph and schizont
  • Other genes localised in this publication: ER membrane protein Sec12, golgi re-assembly stacking protein 1, Sec24 subunit a

Tuteja, R., Pradhan, A., Sharma, S.
Plasmodium falciparum signal peptidase is regulated by phosphorylation and required for intra-erythrocytic growth. (2008 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during intraerythrocytic
  • "To localize PfSP21, we performed co-localization studies with ER marker BiP [30 and [44."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during asexual
  • Other genes localised in this publication: signal peptidase 21 kDa subunit

Pendyala, P. R., Ayong, L., Eatrides, J., Schreiber, M., Pham, C., Chakrabarti, R., Fidock, D. A., Allen, C. M., Chakrabarti, D.
Characterization of a PRL protein tyrosine phosphatase from Plasmodium falciparum. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during intraerythrocytic

Mahajan, B., Selvapandiyan, A., Gerald, N. J., Majam, V., Zheng, H., Wickramarachchi, T., Tiwari, J., Fujioka, H., Moch, J. K., Kumar, N., Aravind, L., Nakhasi, H. L., Kumar, S.
Centrins, cell cycle regulation proteins in human malaria parasite Plasmodium falciparum. (2008 Nov 14, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum
  • "To confirm that PfCEN3 localizes to centrosomes in the nuclear membrane, parasite ER/nuclear membrane was stained with anti-BiP antibody, which labels an ER resident protein."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER
  • Other genes localised in this publication: centrin-1, centrin-2, centrin-3, centrin-4, alpha tubulin 1

Ayong, L., Pagnotti, G., Tobon, A. B., Chakrabarti, D.
Identification of Plasmodium falciparum family of SNAREs. (2007 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during trophozoite

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

endoplasmic reticulum

Charneau, S., Bastos, I. M., Mouray, E., Ribeiro, B. M., Santana, J. M., Grellier, P., Florent, I.
Characterization of PfDYN2, a dynamin-like protein of Plasmodium falciparum expressed in schizonts. (2007 Jun, Microbes Infect) PubMed / full text
   more detail about this publication

endoplasmic reticulum during schizont
  • "Merged images of PfDYN2 (green) and the ER PfBIP (red, df), the apicoplast PfACP (red, gi) and the Golgi apparatus PfERD2 (red, jl)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: FcB1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during schizont
  • Other genes localised in this publication: dynamin-like protein, acyl carrier protein, ER lumen protein retaining receptor

Witola, W. H., Pessi, G., El Bissati, K., Reynolds, J. M., Mamoun, C. B.
Localization of the phosphoethanolamine methyltransferase of the human malaria parasite Plasmodium falciparum to the Golgi apparatus. (2006 Jul 28, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and schizont and trophozoite

Klemba, M., Goldberg, D. E.
Characterization of plasmepsin V, a membrane-bound aspartic protease homolog in the endoplasmic reticulum of Plasmodium falciparum. (2005 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum and not golgi apparatus during intraerythrocytic
  • "Extensive colocalization of PM V and BiP was observed (Fig. 5C). In contrast, PM V did not colocalize with the Golgi marker ERD2 (Fig. 5D), which is distributed in small, juxtanuclear foci as previously described"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: HB3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER and not Golgi during asexual
  • Other genes localised in this publication: plasmepsin V, ER lumen protein retaining receptor

Struck, N. S., de Souza Dias, S., Langer, C., Marti, M., Pearce, J. A., Cowman, A. F., Gilberger, T. W.
Re-defining the Golgi complex in Plasmodium falciparum using the novel Golgi marker PfGRASP. (2005 Dec 1, J Cell Sci) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring

Li, H., Han, Z., Lu, Y., Lin, Y., Zhang, L., Wu, Y., Wang, H.
Isolation and functional characterization of a dynamin-like gene from Plasmodium falciparum. (2004 Jul 30, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

endoplasmic reticulum during late intraerythrocytic
  • "The cellular localization of Pfdyn1 was compared with the known ER-resident protein, PfGRP, with a rat polyclonal anti-PfGRP antibody to identify the endoplasmic reticular structure inside the parasite cytoplasm"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: Dd2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during late asexual stage
  • Other genes localised in this publication: dynamin-like protein

Topolska, A. E., Lidgett, A., Truman, D., Fujioka, H., Coppel, R. L.
Characterization of a membrane-associated rhoptry protein of Plasmodium falciparum. (2004 Feb 6, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum during early intraerythrocytic
  • "To ascertain RAMA trafficking through the compartments of the secretory pathway, we performed double staining IFA using mouse anti-RAMA-E sera and rabbit antibodies to either ER marker (PfGRP) or Golgi marker (PfERD2) proteins."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during early intraerythrocytic stages
  • Other genes localised in this publication: rhoptry-associated membrane antigen, ER lumen protein retaining receptor

Santiago, T. C., Zufferey, R., Mehra, R. S., Coleman, R. A., Mamoun, C. B.
The Plasmodium falciparum PfGatp is an endoplasmic reticulum membrane protein important for the initial step of malarial glycerolipid synthesis. (2004 Mar 5, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and schizont and trophozoite
  • "Coverslips were incubated simultaneously with affinity-purified anti-PfGatp antibodies (diluted 1:10) and either mouse monoclonal antibodies (Sigma) to the red blood cell Band 3 protein (diluted 1:500) or rat polyclonal antibodies (MR4) to the P. falciparum endoplasmic reticulum marker BiP (32) at 37 C with gentle shaking for 1 h."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during ring and troph and schizont
  • Comment: strain information not found
  • Other genes localised in this publication: glycerol-3-phosphate acyltransferase

Akompong, T., Kadekoppala, M., Harrison, T., Oksman, A., Goldberg, D. E., Fujioka, H., Samuel, B. U., Sullivan, D., Haldar, K.
Trans expression of a Plasmodium falciparum histidine-rich protein II (HRPII) reveals sorting of soluble proteins in the periphery of the host erythrocyte and disrupts transport to the malarial food vacuole. (2002 Aug 9, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and trophozoite
  • "They also show decreased transport of resident fv enzyme PfPlasmepsin I, the endoplasmic reticulum (ER) marker PfBiP, and parasite-associated HRPII to fvs."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7, E8
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during ring and troph
  • Other genes localised in this publication: histidine-rich protein II, plasmepsin I, ER lumen protein retaining receptor

La Greca, N., Hibbs, A. R., Riffkin, C., Foley, M., Tilley, L.
Identification of an endoplasmic reticulum-resident calcium-binding protein with multiple EF-hand motifs in asexual stages of Plasmodium falciparum. (1997 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during late trophozoite
  • ""
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: FCR3, D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER during mature trophozoite
  • Other genes localised in this publication: endoplasmic reticulum-resident calcium binding protein

Kumar, N., Koski, G., Harada, M., Aikawa, M., Zheng, H.
Induction and localization of Plasmodium falciparum stress proteins related to the heat shock protein 70 family. (1991 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum
  • "Immuno-gold electron microscopy with cultured parasites revealed nuclear location of Pfhsp and primarily cytoplasmic (probably endoplasmic reticulum) location of Pfgrp"
  • Microscopy type: EM
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from X69121.1, annotation matches, taken directly from 17766381
  • Localisation record: ER
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10057

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PFI0875w heat shock protein 70
MKQIRPYILLLIVSLLKFISAVDSNIEGPVIGIDLGTTYSCVGVFKNGRVEILNNELGNRITPSYVSFVDGERKVGEAAK
LEATLHPTQTVFDVKRLIGRKFDDQEVVKDRSLLPYEIVNNQGKPNIKVQIKDKDTTFAPEQISAMVLEKMKEIAQSFLG
KPVKNAVVTVPAYFNDAQRQATKDAGTIAGLNIVRIINEPTAAALAYGLDKKEETSILVYDLGGGTFDVSILVIDNGVFE
VYATAGNTHLGGEDFDQRVMDYFIKMFKKKNNIDLRTDKRAIQKLRKEVEIAKRNLSVVHSTQIEIEDIVEGHNFSETLT
RAKFEELNDDLFRETLEPVKKVLDDAKYEKSKIDEIVLVGGSTRIPKIQQIIKEFFNGKEPNRGINPDEAVAYGAAIQAG
IILGEELQDVVLLDVTPLTLGIETVGGIMTQLIKRNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERALTKDNHLLGKFEL
SGIPPAQRGVPKIEVTFTVDKNGILHVEAEDKGTGKSRGITITNDKGRLSKEQIEKMINDAEKFADEDKNLREKVEAKNN
LDNYIQSMKATVEDKDKLADKIEKEDKNTILSAVKDAEDWLNNNSNADSEALKQKLKDLEAVCQPIIVKLYGQPGGPSPQ
PSGDEDVDSDEL

Gene-Specific Links for PFI0875w

General Sub-Cellular Localisation Links